KEGG   Uncinocarpus reesii: UREG_03831Help
Entry
UREG_03831        CDS       T01132                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00020  Citrate cycle (TCA cycle)
ure00190  Oxidative phosphorylation
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
ure01200  Carbon metabolism
Module
ure_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ure_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ure_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UREG_03831
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UREG_03831
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UREG_03831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C WRW
Motif
Other DBs
NCBI-GeneID: 8441428
NCBI-ProteinID: XP_002544314
UniProt: C4JLX3
LinkDB All DBs
AA seq 743 aa AA seqDB search
MAAVGLAESGLETACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
DQDAIHYMCREAPRTILELEAYGMPFSRTAEGKIYQRPIGGQSLNYGTGGQAYRTACAAD
RTGHAMLHTLYGQSLKHNCSFLIEFFVLDLMMADGICVGAVALDMETGTLHRLFSKNTIL
GSRVDIVLATGGYGRAYFSCTSAHTSTGDGCAMVARAGLPLQDMEFVQFHPSGIYGAGVL
ITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVARSMNMEIREGRGVGPGRDHIYL
QLSHLPRDLILERLPGIAETASIFAGIDITKQPIPVLPTVHYCMGGIPTNYQGQVLDVDT
ITGKEKTVPGLYAVGETACVSVHGANRLGANSLLDIAVFGRASAQHIAENNEKGMTHAPS
PKDIGMTSFEDMERIRKSDGTKLTAELRLEMQKAMQSDVAVFRTGESLSSGVSRVQQVEQ
AFKKDVCVKDKSLIWNSDLVETLEMRNLLTCAAQTAKSALERKESRGSHAREDFSDRDDD
QFLKHSLSWQGEEAEDVRVGYRAVTFRTLDEIECPSLAKGNKPRENPRVPDSGPAPPAVE
GEENGTKEGQQQRSRSRAAGGYDPAIHGDYDPNAWYAQPQANDASDPASSANPNVLYTAT
GAFNRFTGKWQPIGLTPENFNDENKSRRQLNAYFDVDAAANSHEGKSLKAERAGKKLTKR
ELKAFKEKRREKKEEKRRAWLRD
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtagggttggcagaaagcggattggaaactgcctgcatcacgaaactgttt
ccaacgagatcccacacggtcgctgcgcagggcggcattaacgccgccctggggaatatg
acggaagacgactggagatggcatatgtatgataccgtcaagggttcggattggttaggt
gaccaagatgcaatccattatatgtgcagagaagcccctcggacaatcctagagctagaa
gcctatggcatgcctttctctcgcaccgcagaaggtaaaatataccagcgacctattgga
ggccaatccttgaactatggcaccggcggccaagcatatagaacggcatgcgctgcggac
cgcacagggcatgccatgctgcacacgctttatgggcagtcactgaagcacaattgcagt
ttcttgatcgaattctttgtcctcgacctgatgatggcagatggtatttgcgttggagca
gtcgcgttggacatggagaccggaacactccatcggctatttagcaagaataccattcta
ggcagtcgggttgatattgttctagccactggtggctatggccgtgcgtatttctcttgc
acatcggcacacactagtacgggagatggttgcgctatggtagccagggctggactccct
cttcaagatatggagttcgttcaatttcatcccagtggtatatatggggcgggcgtcttg
ataaccgaaggcgcccgtggagaggggggctatttattgaactcagaaggagaaaggttt
atggaaagatatgccccaactgccaaggatcttgcaagtcgcgacgttgtcgctcgttct
atgaatatggaaattcgcgaaggccgtggcgttgggccggggagggaccacatttacctc
cagttatcgcatctgccacgcgacttgattcttgagcggctgccgggcattgcggaaaca
gcctcgatttttgcaggaatagatatcacaaagcagccgatcccggtgctgcccacggtt
cattattgtatgggtggtattcccaccaactatcaaggccaggtccttgacgtcgacaca
attactggcaaagagaagactgtcccagggctttatgctgttggagaaacagcatgcgtg
agtgtacatggagctaacagacttggtgcgaactcgctccttgacattgctgtttttgga
cgagccagcgcccaacatatcgcagaaaataacgaaaaaggaatgactcatgcaccctca
ccaaaagatattggaatgacatctttcgaagatatggagaggattcgcaaatccgatgga
accaaattaacagctgaattgcgtctggagatgcagaaagctatgcagtcggacgtggca
gttttccgcaccggagaatccctgtcttctggcgtgtctcgggttcaacaagtagagcag
gctttcaagaaagatgtatgtgtcaaggacaaatctttaatctggaactcggacttggtt
gaaaccttggagatgcgtaatctcctcacttgcgcagcacaaacggcaaagagcgctctt
gaaagaaaagaaagccggggaagccatgctcgggaagatttctccgatagagatgatgat
cagtttctaaaacatagcctgtcatggcaaggggaggaggcggaagatgtgcgggttgga
tatcgggcggtcacgtttaggaccctggacgagattgaatgtccgtcgttagccaaggga
aataaacccagggaaaaccctcgggttccggattcagggccagcgccccctgcagttgag
ggtgaagagaatggtaccaaagagggtcagcaacagcggtcgcgttctcgtgctgcagga
ggttatgatccggctattcatggcgactacgatccgaacgcctggtacgcgcagccgcaa
gcaaacgacgcctcggacccagcctcctctgcaaacccaaacgtcctctataccgctaca
ggcgcattcaatcgctttacgggaaaatggcaacctatcggtttaacgccagagaatttc
aatgacgagaacaaaagccgccgccagcttaatgcatacttcgatgttgacgctgcggct
aacagccatgaagggaaaagtctcaaggcggagcgggctgggaagaaattaacaaaaagg
gagctaaaggcgttcaaagaaaagcggagagagaaaaaggaggaaaaaaggcgagcgtgg
ctcagggattga

DBGET integrated database retrieval system