KEGG   Uncinocarpus reesii: UREG_04217
Entry
UREG_04217        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K17825  verruculogen synthase [EC:1.14.11.38]
Organism
ure  Uncinocarpus reesii
Pathway
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    UREG_04217
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.38  verruculogen synthase
     UREG_04217
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-GeneID: 8437230
NCBI-ProteinID: XP_002544700
UniProt: C4JN09
LinkDB
AA seq 296 aa
MTVSAESKPQIPRVSVDSDLTQVKDILEEHGTVIVESLVPRDVVDRLNKDLDPLVEAHPG
GLESEAFPKARLPVSTKWLQFLTATCKTFREDILNNSAIHTICEDVFEPLGDYWLISGTA
MDMAPGCAGQPLHRDDVSHPIIRHLGPEAPITVVAFLIALTPFTAENGSTRVILGSHKWP
TLGRPNEDDTVRAVMNPGDAILITGRIVHGGSRDTTGTPRRLLSLGMGISQLTPYEAHSA
LPRKVIESMTPVAQRMVGWRSLRPAFPNVIGLQTVRMEPMEDYLELKSEQPLEEGA
NT seq 891 nt   +upstreamnt  +downstreamnt
atgactgtctctgctgaatccaagccgcaaatcccccgagtctctgttgacagtgatctg
acccaggtaaaggatattcttgaagagcatggaaccgtgattgtggagagtttggtgccc
cgcgatgtcgttgaccggctgaataaagatttggaccctttggttgaggcccatcctggg
ggtctcgagagcgaggcgttccccaaagcccggctgcctgtctccacgaaatggctccaa
ttcctcactgcaacttgcaaaacatttcgagaggacatcctcaataactcggctatacat
actatatgcgaggacgtcttcgagcccctgggtgattattggttgatatcaggaaccgcg
atggatatggctcccggttgtgcgggccagccactgcaccgagacgacgtttcgcacccg
atcatccggcacctgggacctgaggccccaattacagtggttgcgtttttgatcgccttg
actcccttcaccgcggagaacggttccaccagggtcatcctgggcagccataaatggccc
acgctcggtcggcccaacgaagacgatacggtcagggcggtaatgaatccaggagatgca
atccttattaccgggcggattgtccatgggggaagtcgagacactacaggaacccctcga
cgactcctcagcttgggaatgggcatctctcaattgactccatacgaggcgcattcggcg
ctgccccgcaaagtcattgagagtatgaccccggtagctcagcgaatggtgggctggagg
agcctgcgtccggcattcccgaacgtgatcgggcttcagacagtgcggatggagcccatg
gaggactacttggagttgaagtcggagcagccgcttgaagagggggcataa

DBGET integrated database retrieval system