KEGG   Uncinocarpus reesii: UREG_05308Help
Entry
UREG_05308        CDS       T01132                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ure00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    UREG_05308
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UREG_05308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 8442166
NCBI-ProteinID: XP_002584619
UniProt: C4JS69
LinkDB All DBs
AA seq 235 aa AA seqDB search
MATIALRSSLTGTTLRAGVSTARVNTAGLSGIAGSRFFAAKATLPDLPYDYGALEPSISG
KIMELHHKKHHQTYVNSYNDAVQKLAEAQEKCDIQSQISLQHLTNFHGGGHINHSLFWEN
LAPSKNGGGEPPSGSLSKAIDDAYGSLDDFKKKFNTALAGIQGSGWAWLVKDKQTGDIMI
KTYANQDPVTGQYTPLLGIDAWEHAYYLQYENRKAEYFSAVWDVVNWKTVEKRYA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctacaattgcccttcgctcatctctgacgggcaccaccctgcgtgccggtgtctct
acagctcgtgttaacactgcaggcctctcagggatcgccggttctcgcttctttgctgca
aaggctacacttccggatttgccatatgactatggagcacttgagccctccatctccggc
aaaatcatggaacttcaccacaagaagcaccaccagacctatgtaaactcctacaacgac
gctgtccagaaactcgccgaggctcaggaaaaatgcgatatccaatctcagatctctctg
cagcatctgacgaacttccacggcggtggccacatcaaccactccctcttctgggagaat
ttggctccaagcaagaacggcggcggtgagccacctagtggttctctctccaaggccatt
gacgatgcgtacggcagcttggatgattttaagaagaagttcaacacggcgttggcggga
attcagggaagcggttgggcctggttggtcaaggacaagcaaacgggggacatcatgatc
aagacttatgctaaccaagatcccgttaccggccaatacactcccctccttggaattgac
gcttgggagcacgcatactacctccaatacgaaaaccgcaaggcggaatattttagtgct
gtttgggatgtcgtcaactggaagacagttgagaaaagatatgcctag

DBGET integrated database retrieval system