KEGG   Uncinocarpus reesii: UREG_05316Help
Entry
UREG_05316        CDS       T01132                                 

Definition
(RefSeq) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ure  Uncinocarpus reesii
Pathway
ure00020  Citrate cycle (TCA cycle)
ure00310  Lysine degradation
ure00380  Tryptophan metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01130  Biosynthesis of antibiotics
ure01200  Carbon metabolism
Module
ure_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ure_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UREG_05316
  09105 Amino acid metabolism
   00310 Lysine degradation
    UREG_05316
   00380 Tryptophan metabolism
    UREG_05316
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     UREG_05316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 8442176
NCBI-ProteinID: XP_002584627
UniProt: C4JS77
LinkDB All DBs
AA seq 1063 aa AA seqDB search
MLRATRSSTLKVSEAASLLRKTPSARNARWIASSSKPTSLSSRAKLGLAPRRPLALVGAQ
EVWKQRRQYAIAAEETNKGVDPNDSFLQGNTADYIDEMYLAWKKDPSSVHISWQTYFHNM
EEGNMPISQAFQPPPTLVPTPTGGVPQHMPTSRTAAGAEVSNHLKVQLLVRAYQARGHHK
AKIDPLGIRGEAEAFGYSKPKELELSHYGFTESDLDQEFALGPGILPRFETETRKKMTLR
EIIAACERIYCGSFGIEYIHIPDREPCDWIRDRVEIPQPYKYSVDEKRRILDRLIWSTSF
EAFLATKFPNDKRFGLEGCETLVPGMKALIDRSVDYGIKDIVIGMPHRGRLNVLSNVVRK
PNESIFSEFTGTAEPGDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVL
GKTRAIQHYNHDEKNFNSAMGVLLHGDAAFAAQGVVYETMGFQSLPAYSTGGTVHIIVNN
QIGFTTDPRFARSTPYCSDIAKAIEAPVFHVNADDVEAVNFVCQMAADWRAQFKSDVVID
IVCYRKQGHNETDQPAFTQPLMYKRIADQTSQLEKYVDKLLSENSFTKEDIEEHKKWVWG
MLNDSFDRSKDYQPTSREWLTSAWNGFKSPKELATEVLPHLPTGVSHENLRTIGDKISEA
PEGFNVHRNLKRILANRKKTVDEGKNIDWATAEALAFGTLCNEGHHVRVSGQDVERGTFS
QRHAVLHDQESEATYTPLQHISENQGTFVISNSSLSEFGVLGFEYGYSLTSPNALVMWEA
QFGDFANNAQCIIDQFIASGEVKWLQRSGLVMSLPHGYDGQGPEHSSGRIERYLQLCNED
PRVFPSPDKLDRQHQDCNMQIAYMTTPANLFHILRRQINRQFRKPLIIFFSKALLRHPIC
RSSIEDFTGDSHFNWIIPETEHGKSIAEPEQIDRVILCTGQVYAALVKHREAQGIKNTAI
TRIEQLNPFPWQQLKDNLDSYPNAKDIVWCQEEPLNAGAWSFVQPRIETLLNNTEHHNRR
HVLYAGRNQSASVATGLKASHIKEEQELLHDAFTVHQDKLKGE
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgctactagatcgtcgaccttgaaggtctcagaggctgcgagcctgctgaga
aaaactccctctgcgcgcaatgctcggtggatcgcgtcctcctcgaaaccgacgtcgctg
tcgagtcgtgcgaagctgggcttggctccccggagaccattggcgttggtgggagctcag
gaagtgtggaagcagcgtaggcaatatgcgattgcggctgaggagacgaataaaggagtg
gatcccaatgattcattccttcaaggcaataccgcggactacatcgacgagatgtacttg
gcgtggaaaaaggatccgtcaagcgttcacatttcgtggcagacctacttccataacatg
gaagaagggaacatgcccatctcgcaagccttccagccgccacctactctcgttcctact
cccactggcggagtcccccagcacatgcccacctcccgcaccgccgccggagccgaagta
tcgaatcacttaaaggtccaattgctcgtccgcgcataccaggcgcgtggtcaccacaaa
gcgaagattgaccctttgggtattcgcggagaagctgaggcgtttggatactcgaaaccc
aaggagctggagctttcgcactatggatttacggaatcggatttggatcaggaattcgca
cttggacccggcattcttcctcgttttgaaacagaaacgagaaagaagatgactctccgt
gagatcattgcggcttgcgagcgcatttactgtggttcctttggtatcgagtacatccac
attcccgaccgtgagccttgcgactggatccgtgatcgtgtagaaatccctcaaccgtac
aagtactctgtcgatgagaaacgccggattctggaccgtctaatttggtctacctccttt
gaagcgttcctggccacgaaattcccgaacgacaagcgattcggcttggaaggctgcgaa
accctcgttcctggaatgaaagctttgattgaccgaagcgtcgactatggcatcaaggac
attgtgattggtatgcctcatcgtggtcgtttgaatgtgctgagcaacgtcgtgcgaaaa
ccgaacgagtcgatcttcagcgaattcaccggtaccgccgaaccaggcgacgaaggctct
ggagatgtgaaataccatctcggtatgaactttgagcgcccgactccctctggcaaacgt
gtccagctttccctagttgcgaacccgtctcatcttgaagccgaagatcccgtcgtgctt
ggaaagacccgcgcaattcagcactacaaccatgacgagaagaacttcaacagcgccatg
ggtgtgttgctccatggtgatgctgctttcgccgcccagggtgttgtctacgagactatg
ggctttcagtcgttgcctgcctactcgaccggcggtacagttcacatcatcgtgaacaac
cagatcggtttcactactgaccctcgtttcgctcgctctaccccgtactgctctgatatt
gccaaagcgatcgaagcccctgtcttccacgtcaacgctgacgatgtcgaggccgtcaac
tttgtttgccaaatggccgctgactggcgtgctcagttcaagagtgatgtcgttattgac
attgtctgctaccgtaaacagggccacaacgaaaccgaccaaccggccttcacccaacca
ttgatgtacaagcgtatcgctgaccaaactagtcaattggaaaaatacgtcgacaagctc
ttgagtgagaactcgtttaccaaggaagacatcgaggaacacaagaaatgggtctgggga
atgctcaacgacagctttgatcgcagcaaggactaccagcctacgagcagagaatggctg
acttctgcctggaacggattcaagtctcccaaggagcttgcgaccgaggttctccctcac
ctcccaaccggtgtttcccatgaaaacctgcgcacgatcggagataagatcagcgaggca
cctgagggattcaacgtccaccgcaacctcaagcgtattctcgcgaacagaaagaagacc
gtggatgagggcaaaaacattgactgggccactgcggaagctctcgcttttggtacgctg
tgcaacgaaggccatcatgtccgtgtctccggccaggatgttgagcgcggtactttctcc
cagcgacatgctgttttgcacgaccaggagagtgaggcgacctatacgcctttgcagcac
atcagtgagaaccagggtacatttgttatctctaactcctcgctcagcgagtttggcgtt
cttggattcgaatacggctactcattgacatcgcccaatgctctggtcatgtgggaagct
caatttggcgattttgccaacaacgctcagtgcatcatcgatcagttcatcgcctctggt
gaagtaaagtggctccagcgatctggcttggtcatgtccctgcctcacggttatgacggt
caaggtcctgagcactcttctggcagaatcgaacgttatctccagctttgcaatgaggat
ccgcgtgtattcccgtctcccgacaagctcgatcgccaacatcaggactgcaacatgcaa
attgcttacatgaccactcctgccaacttgttccacatcctccgtagacagatcaaccgc
cagtttagaaaacctcttatcatcttcttctccaaagctctcttgcgtcatccaatttgc
cgttcgtccatcgaagacttcaccggcgactcccacttcaactggattatccctgagact
gaacacggcaagtccatcgcagaacccgagcagatcgatcgcgtcatcctttgtacgggt
caggtatacgccgcgctcgtcaaacaccgcgaggcccagggcatcaagaataccgccatc
actcgtatcgaacaacttaaccccttcccgtggcaacaactcaaggacaaccttgacagc
tatcccaacgccaaagacattgtttggtgccaggaagaaccgctcaacgcgggtgcctgg
agctttgtccaaccacgcattgagacgctgttgaacaataccgagcaccataaccgtcgc
catgtcctgtatgctggccgtaaccagagtgccagtgtcgccactggattgaaagccagc
cacatcaaggaggagcaggaattgttgcacgatgcattcaccgtgcatcaggataaattg
aagggagagtag

DBGET integrated database retrieval system