KEGG   Uncinocarpus reesii: UREG_06007Help
Entry
UREG_06007        CDS       T01132                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ure  Uncinocarpus reesii
Pathway
ure00250  Alanine, aspartate and glutamate metabolism
ure00410  beta-Alanine metabolism
ure00430  Taurine and hypotaurine metabolism
ure00650  Butanoate metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
Module
ure_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    UREG_06007
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UREG_06007
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UREG_06007
   00430 Taurine and hypotaurine metabolism
    UREG_06007
Enzymes [BR:ure01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UREG_06007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 8438913
NCBI-ProteinID: XP_002585318
UniProt: C4JU68
LinkDB All DBs
AA seq 439 aa AA seqDB search
MASFVGTYMEREAQDLLVENMSKNLADADEYPALMDIHARCISMIANMWHPQPGEHPIGT
ATTGSSEAIQLGGLAMKRRWQEKRKAEGKDASKPNIIMGANAQVALLKFARYFDVEARIL
DVCEESHYRLDPKEVKKNVDENTIGIFVILGSTYTGHYEPVEEISNILDEVEKEHGWDIP
IHVDGASGGFIAPFTHAGAGGPKWDFNLPRVHSINVSGHKFGLVYVGLGWVIWRDRQYLP
KDLIFQLHYLGGTEESFALNFSRPGLQVIGQYYNIIRLGFDGYREVMENCLRNARLLSKA
LERTGWYVCVSDIHRKKGEYEFRGVGGVQPYHEGETSADYNEGLPVVAFRFSDQFKNDFP
DVKQESISLLLRAKQYIIPITERVMASEPIDLAALQGKPTSLARRQGKPEAKPLKKVTRA
KAGEGTHHPMAKGGHRSVC
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctagttttgttggcacctatatggaacgcgaagcccaggatttactcgttgagaac
atgagtaagaacctcgcggacgctgacgagtatcctgccctaatggatatccacgcgcgg
tgcatttcaatgattgcaaacatgtggcatccacagcctggtgagcatcccattggaacg
gccacaacaggatcatcagaggcaatccagcttggtggtttggctatgaagcgacgatgg
caagaaaagcgcaaagccgaaggaaaggatgcatcaaagcctaatataatcatgggagca
aatgcacaggtagcattattgaaatttgcgaggtatttcgatgttgaggcccggatactc
gacgtgtgtgaggagagtcactaccggcttgatccaaaggaggtcaagaaaaatgtggat
gagaacactattggcatatttgtcattttgggcagtacctataccggccattacgagcct
gtagaggagatctccaacatcctagatgaagtggaaaaggaacatggatgggatataccg
atccacgttgatggggccagtggtggctttatcgctccatttacgcacgctggggctggt
ggccctaaatgggatttcaacttgccgcgtgtgcactcaatcaacgtatcaggccataaa
ttcggcctcgtatatgtgggattaggatgggttatttggcgcgatcgccagtatctgcct
aaggacctcatttttcaactgcactacctggggggcacagaagaatcgttcgcattgaat
ttctctcgtcctgggctgcaggtaatcggccaatattacaatatcattcgccttggattt
gacgggtaccgggaagtgatggaaaactgtctccgaaacgcacggctcttgagtaaggcg
cttgaaagaacgggctggtatgtctgtgtcagcgacatccaccgcaagaaaggcgagtat
gaattccgtggcgtgggcggtgtccagccgtaccacgaaggggagacatcggcagattac
aacgaaggtttacctgtcgtcgcatttcggttttccgatcaattcaaaaacgacttcccg
gacgtcaaacaagagtcaattagtttgctgctgagagcaaagcaatatatcatccccatt
acggagcgggtgatggcttctgagccgatagatctggcagcgctgcagggcaagccgaca
tcactcgcacggcgccagggaaaaccagaggccaaacccctgaagaaagtcacaagagcc
aaagccggagaaggaacgcaccatcccatggcaaagggtggccatcgctcggtctgttga

DBGET integrated database retrieval system