KEGG   Uncinocarpus reesii: UREG_07786Help
Entry
UREG_07786        CDS       T01132                                 

Definition
(RefSeq) uridylate kinase
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
ure  Uncinocarpus reesii
Pathway
ure00240  Pyrimidine metabolism
ure01100  Metabolic pathways
Module
ure_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ure00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    UREG_07786
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     UREG_07786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 Thymidylate_kin Ploopntkinase3 MerR EII-GUT
Motif
Other DBs
NCBI-GeneID: 8442313
NCBI-ProteinID: XP_002583013
UniProt: C4K035
LinkDB All DBs
AA seq 246 aa AA seqDB search
MSSQTKPSTASAPPAPSTVPPELTPPLTSNNTAPRFSQKDVSVVFVLGGPGSGKGTQSAN
LVRDYGFSHLSAGDLLRAEQNREGSKYGELIRHYIREGLIVPMEITVALLSNAMADILEE
RRAQNTLRAGVPSRFLIDGFPRKMDQAVFFEETVVPSVATLFLSCPEEVMLNRLLKRGET
SGRADDNIESIHKRFRVFIDQSMPVVEHYEKEGKVMTVSSVGTIDEVYSGVKKEIEGRGI
KPVKEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagccaaactaagccctccacggcctccgcgcccccagccccctcgaccgtcccg
cccgaactgacccctccattaacctcgaataacaccgctcccaggttctcccaaaaggac
gtctccgtggtctttgttctcggcgggcccggcagcgggaaaggcacccagtccgccaac
cttgtgcgcgactacggcttctcccacttatccgcgggcgacctactccgcgcggagcaa
aaccgagagggaagcaagtacggcgagctgatccgccattatatccgcgagggcctcatt
gttcccatggagatcacggtcgccttgctttccaacgccatggccgatattctcgaggag
cggagagcacagaatacgctccgcgctggcgtcccgtcacggttcttgatcgatggattc
ccgcgtaaaatggatcaggcggttttctttgaagagactgtcgtcccgtcggttgctact
ctgtttctttcttgcccggaggaggtgatgcttaaccgcttgcttaagcgcggggagact
agcggtcgcgcggacgataacattgagtcgatccacaagcggttccgcgtttttatagac
cagagcatgccggtggtcgagcattacgaaaaggagggaaaggtcatgaccgtgtcttct
gttggaaccatagatgaagtttacagtggggtgaagaaggagatcgaaggccgcgggatc
aagccagtaaaagaaaattaa

DBGET integrated database retrieval system