KEGG   Variovorax sp. PAMC 28711: AX767_03090Help
Entry
AX767_03090       CDS       T04325                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
vaa  Variovorax sp. PAMC 28711
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AX767_03090
Enzymes [BR:vaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     AX767_03090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 ADH_N_assoc RhaT
Motif
Other DBs
NCBI-ProteinID: AMM23453
UniProt: A0A126Z8K1
LinkDB All DBs
Position
complement(596388..597422)
Genome map
AA seq 344 aa AA seqDB search
MEALVIHAPGDLRVEEVPTPALGADQLQVRVRCGGICGSDLHYYQHGGFGTIRIKEPMVL
GHEIAGVIEAVGSSVTGFAAGQRVAVSPSRPCGTCRYCQQGLQNHCLDMRYYGSAMRTPH
VQGAFRQQIVVETHQAHLLADSVSDGEGSMAEPLSVALHAVRRAGSLLGKRVLVTGCGPI
GALAIIAARRAGAAHIVATDVGAHTLGKALKVGADEVVNVADEPDGLQRFTADKGSFDVL
FEASGNARALVGAFDALRPRGIIVQLGLGGEMTLPINTIVAKEFDLRGAFRFHEEFAMAV
GLLNKGLVDVKPLISATLSYRDSARAFALAADRSQAMKVILNFD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccttgtcattcatgcccccggcgacctgcgcgtcgaggaggttccgacaccc
gcactcggcgccgaccagctgcaggtgcgcgtgcgctgtggtggcatctgcggatcggac
ctgcactactaccagcatggcggctttggcacgattcgcatcaaggaaccgatggtgctg
ggccacgagatcgccggtgtcatcgaggcggtcggttcgtcggtgaccgggttcgctgca
gggcaacgcgtggcggtgagcccgagccgcccgtgcggaacttgtcggtactgtcagcag
ggcctgcaaaaccattgcctcgacatgcgctactacggcagcgcgatgcgcacgccgcac
gtgcagggcgctttccggcagcagatcgtggtcgaaacgcatcaggcgcacctgctcgca
gattcggtgagcgacggcgaaggctcgatggccgagccgctgtcggtcgcgctgcacgcg
gtgcgccgcgccggctcgctgctcggcaagcgggtgctggtcaccggctgcggcccgatc
ggcgcgctggccatcattgccgcgcgaagggcgggcgccgcgcacatcgtggccacggac
gtcggcgcgcatactttgggcaaggcgctcaaggtcggggccgacgaggtcgtcaacgtg
gcggacgagccggacggccttcagcgcttcactgccgacaaaggcagcttcgatgtgctg
ttcgaggccagcggaaacgcccgcgcgctggtcggtgccttcgacgcgttgcgtcctcgc
ggcatcatcgttcagctcggtctgggtggcgagatgacgctgccgatcaacaccatcgtg
gccaaggaattcgatctgcgcggcgcgttccgttttcacgaggagttcgccatggcggtg
ggcttgctcaacaaggggctggtcgacgtgaagccgctcatttccgcaacgctgtcgtat
cgcgattcggcccgtgccttcgcactggccgccgaccggtcgcaggccatgaaggtgatc
ctgaacttcgactga

DBGET integrated database retrieval system