KEGG   Variovorax sp. PAMC 28711: AX767_04335Help
Entry
AX767_04335       CDS       T04325                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00620  Pyruvate metabolism
vaa00710  Carbon fixation in photosynthetic organisms
vaa01100  Metabolic pathways
vaa01120  Microbial metabolism in diverse environments
vaa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AX767_04335
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AX767_04335
Enzymes [BR:vaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     AX767_04335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AMM23656
UniProt: A0A126Z9F8
LinkDB All DBs
Position
847243..849543
Genome map
AA seq 766 aa AA seqDB search
MAAPLSPAEEALREAAREYHRSPVRGKISITPTKPLMNQRDLSLAYSPGVAYPCLDIQAD
PALAAEYTSRGNLVGVVTNGTAVLGLGNIGPLASKPVMEGKACLFKKFAGIDVFDIELAE
NDPDKLVDIIAALEPTLGGINLEDIKAPECFYIEKKLRERMNIPVFHDDQHGTAIISAAA
LLNGLELVGKKIEDVKIAVSGAGAAALACLDVMVGLGAQPKNIFAVDSKGLIYMGRAGGF
DDSKSRYAQKDTGLRTLADVVSQADVFLGCSAPGVLTAEMVKSMGTQPIILALANPEPEI
RPELAKAVRPDCIIATGRSDYPNQVNNVLCFPYIFRGALDCGASKITEEMKLACVREIAD
LTKADISEEVATAYAGQELVFGPDYIIPKPFDSRLILRIAPAVAKAAAASGVAARPIEDL
EAYRQHLTRFVYQTGMFMRPVFTAAKLATAKRVAYAEGEDDRVLRAAQLAVDEGLARPIL
IGRPAIIEMRVQKAGLRLKLGSDVEIVDPENDPRFRTYWEAYHKLMGRRGITPEASKAMV
RRSNTTIASLMVHLGDADAMLCGLVGRFDSHLKILGQILGSKRGSPGFAALNALTLDSGT
VFIADTHVNEDPSAEMLADIAMMAAEEVRRFGLPPKVAFLSHSNFGSSEHASARKMRIAR
DLFARMAPDIECDGEMHGDAALSEEVRRTAMPDTTLTGEANLLICPNLDSANILYNVLKM
KGANGITVGPILLGASHSAHVLTASATVRRIVNMTALAVADANIPK
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccctctttccccggcagaagaagcccttcgcgaagccgcacgcgaataccac
cgcagcccggtgcgcggcaagatttcgatcacgccgaccaagccgctgatgaaccagcgc
gacctgtcgctggcctactcgcccggcgtggcgtatccgtgtctcgacatccaggccgac
ccggcgctcgcggccgagtacacctcgcgcggcaacctggtcggtgtggtcaccaacggc
accgcggtgctcggcctcggcaacatcggcccgctggcctccaagcccgtgatggaaggc
aaggcctgcctcttcaagaaattcgcgggcatcgacgtgttcgacatcgagctcgccgag
aacgatcccgacaagctggtcgacatcatcgccgcgctcgagccgacgctcggcggcatc
aacctcgaggacatcaaggcgcccgagtgcttctacatcgagaagaagctgcgcgagcgc
atgaacattccggtgttccacgacgaccaacacggcaccgccatcatctcggccgccgcg
ctgctcaacgggctggagctggtcggcaagaaaatcgaggacgtgaagatcgccgtctcg
ggtgccggggccgcggcgctggcgtgtctcgacgtgatggtcggcctcggcgcccagccg
aagaacatcttcgcggtcgattccaagggtctgatctacatgggccgcgccggcggcttc
gacgactcgaaatcgcgctatgcgcaaaaggacacgggcctgcgcaccctggccgacgtg
gtctcgcaagccgatgtgttcctcggctgctccgcacccggcgtgctgacggccgagatg
gtcaagagcatgggcacgcagcccatcatcctggcgctggcgaacccagagcccgagatt
cgccccgagctggccaaggccgtgcggcccgactgcatcatcgccacgggccgatcggac
tatccgaaccaggtcaacaacgtgctgtgcttcccgtacatctttcgcggcgcgctcgac
tgcggcgccagcaagatcaccgaggaaatgaagctggcctgcgtgcgcgagatcgccgac
ctcaccaaggccgacatcagcgaagaagtcgctaccgcttacgccgggcaagagctggtg
ttcgggccggactacatcattccgaagcccttcgattcgcgcctgatcctgcgcatcgca
ccggccgtggccaaggcggcggcggcatcgggcgtggcggcccggccgatcgaagacctc
gaggcgtatcgccagcacctcacgcgcttcgtctaccagaccggcatgttcatgcgcccg
gtcttcaccgcggccaagctcgccaccgccaagcgcgtcgcgtatgccgagggtgaagac
gaccgcgtgctgcgcgcggcccagctggcggtcgacgagggactggccaggccgatcctg
atcgggcggcccgccatcatcgagatgcgcgtgcagaaggccggcctgcgcctgaagctc
ggctccgatgtcgagatcgtcgaccccgagaacgacccgcgctttcgcacctactgggag
gcataccacaagctcatgggccgccgcggcatcacgcccgaagcgtcgaaggcgatggtg
cgccgctccaacaccaccatcgcctcgttgatggtgcatctgggtgatgccgacgccatg
ctgtgcgggctggtcgggcgcttcgacagccacctcaagatcctgggccagatcctcggc
agcaagcgcggctcgccgggcttcgcggcactgaacgcgctgacgctcgacagcggcacc
gtgttcatcgccgacacccatgtcaacgaagacccgagcgccgagatgctcgccgacatc
gcgatgatggcggccgaggaagtgcgccgcttcggcctgccgcccaaggtcgccttcttg
tcgcactccaacttcggcagctcggagcacgcctcagctcgcaagatgcgcatcgcacgc
gacctcttcgcgcgcatggcgcccgacatcgaatgcgacggcgaaatgcacggcgacgcg
gcgctctccgaagaagtgcgccgcaccgcgatgcccgacacgacgctgaccggcgaggcg
aatttgttgatctgcccgaacctcgactcggccaacatcctctacaacgtgctgaagatg
aagggcgcgaacggcatcacggtcggtccgatcctgttgggcgcctcgcactcggcccat
gtgctcaccgcatcggccacggtgcgccggatcgtcaacatgacggcgctggccgtcgcc
gacgcgaacatcccgaagtga

DBGET integrated database retrieval system