KEGG   Variovorax sp. PAMC 28711: AX767_05610Help
Entry
AX767_05610       CDS       T04325                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vaa01100  Metabolic pathways
vaa01110  Biosynthesis of secondary metabolites
vaa01130  Biosynthesis of antibiotics
vaa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AX767_05610
Enzymes [BR:vaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AX767_05610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_17 Cytidylate_kin2 Cytidylate_kin KTI12 AAA_22 CoaE AAA_16 AAA AAA_28 FtsK_gamma MMR_HSR1 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: AMM23879
UniProt: A0A126Z9U4
LinkDB All DBs
Position
complement(1102267..1102812)
Genome map
AA seq 181 aa AA seqDB search
MAVAFVGLPGAGKSAVGRRLAQRLQLPFVDSDHVIEQRIGCSIREYFDREGETNFRDVEQ
SVIADLAANARGVVATGGGAVLRQPNRVQLRDRFHVIYLRSSPEDLFRRLRHDVKRPLLQ
VADPLGRLRELHSVRDPLYSETAHDVVETGRPSVSMLVNIILMQLELAGVTLSDPQAEPP
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtcgcatttgtcgggttgcccggcgccggaaaatccgcggtgggccggcggctg
gcgcagcgcctgcagcttcctttcgtcgacagtgaccatgtcatcgagcagcgcatcggc
tgctcgatccgcgagtatttcgaccgcgaaggcgagacgaacttccgcgatgtcgaacag
tcggtgatcgctgatctcgccgccaacgcgcgcggcgtggtggcaaccggcggcggtgcg
gtgttgcgccagccgaatcgcgtccaattgcgcgaccgctttcacgtgatctatttgcgc
tcttcgccggaagatctctttcggcgcttgcgccacgatgtgaagcgccccttgctccag
gtggccgatccgctcggtcgactgcgcgaacttcattcggtgcgcgatccgctctacagc
gagacggcgcacgacgtcgtcgaaaccggccggccctccgtctccatgctcgtcaacatc
atcctgatgcagctcgaactcgccggcgtgaccctgtcggatccgcaagccgagccgccg
ccctga

DBGET integrated database retrieval system