KEGG   Variovorax sp. PAMC 28711: AX767_06945Help
Entry
AX767_06945       CDS       T04325                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00550  Peptidoglycan biosynthesis
vaa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AX767_06945
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AX767_06945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vaa01011]
    AX767_06945
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vaa03036]
    AX767_06945
Enzymes [BR:vaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AX767_06945
Peptidoglycan biosynthesis and degradation proteins [BR:vaa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AX767_06945
Chromosome and associated proteins [BR:vaa03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AX767_06945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AMM24114
UniProt: A0A126ZC11
LinkDB All DBs
Position
complement(1391853..1393607)
Genome map
AA seq 584 aa AA seqDB search
MARNSRSVQYASSPLLASKTPVWRSKFIVAGIALCFLVLAARAAYVQVFGNAFFQRQGEV
RFTRTLELPANRGRILDRNGLILASSVVAPSIWAIPEDVERDDPEVKAKLKQVAKLLEMS
QKDFDKKLEDEDKTFVWVKRQVDAPIAKQIADLNIKGIYQRKEYKRQYPEGEAAAHVVGF
TNVEDSGQEGIELEFNKELAGKAGSRRVIKDRLGRVVEGVGETIPPLDGKDIQLSVDSKV
QFFAYQKLRDAVILRKAKAGSVVVLDSITGEVLALANYPSYVPDKRQNLTGEQLRNRAMT
DTFEPGSTMKPITVGMALEAGRVKPSTIIDTSPGRYQLGGFTISDTHNYGALTVEGVIQK
SSNVGALKIAQKMQPHEMWDTYTALGYGQKPVIQFPGAVTGRLRPWKTWKPVEQATMAYG
YGLSASLFQMAHSYTSFAHDGSVIPVTMLKSAVPAVGVRVFSAENAHAVRKMLQMAAAPG
GTGPLAQTVGYSVGGKSGTAHKQVGKGYASNKYRAWFTGMAPIEKTRIIVGVMIDEPSDG
VYFGGLAAAPVFSEVVQQTLRMMNVPPDLAVKPLVTTQGVDESF
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaacagtcgtagcgtgcagtacgcctccagccccttgctcgcaagcaagacg
ccggtctggcgcagcaagttcatcgtggccggcatcgcgttgtgctttctggtgctggca
gcgcgcgccgcgtatgtgcaggtgttcggcaacgcgttcttccagcgccagggcgaagtg
cgtttcacgcgcacgctcgagctgcccgccaaccgcggccgcatcctggaccgcaacggg
ctcatcctcgcgtccagcgtggtggcgcccagcatctgggcgattcccgaagacgtcgaa
cgcgacgacccggaagtgaaggccaagctcaagcaggtcgccaagctgctcgagatgtcg
cagaaggatttcgacaagaagctcgaagacgaagacaagacctttgtctgggtcaagcgg
caggtcgacgcccccatcgccaagcagatcgccgacctcaacatcaagggcatctaccag
cgcaaggaatacaagcgccagtaccccgaaggcgaagcggccgcgcacgtggttggcttt
accaacgtcgaggacagcgggcaggaaggcatcgagctggagttcaacaaggagctggcc
ggcaaggcgggttcgcgtcgcgtcatcaaggaccggctcggccgcgtggtcgaaggcgtc
ggcgaaacgattccgccgctcgacggcaaggacatccagctcagcgtcgacagcaaggtg
cagttcttcgcctaccagaagctgcgcgatgcggtcatcttgcgcaaagccaaggcgggc
agcgtcgtggtgctcgactcgatcaccggcgaggtgctggcgctcgccaactacccgagc
tacgtgcccgacaagcgccagaacctgaccggtgaacagctgcgcaatcgcgcgatgacc
gacaccttcgagcccggttcgacgatgaagccgatcaccgtcggcatggcgctcgaagcc
ggccgcgtgaagccttcgaccatcatcgacaccagccccggccgctaccagctgggcggc
ttcacgatcagcgacacccacaactacggtgcgctgacggtggagggcgtgatccagaaa
tcgagcaacgtgggcgcgctcaagatcgcgcagaagatgcagccgcacgagatgtgggac
acctacaccgcgctcggctacggccagaaacccgtgatccagttccccggcgccgtgacc
gggcgcctgcgtccgtggaagacctggaagcccgtcgagcaggccacgatggcctatggc
tacggcctctcggcatcgctgttccagatggcgcattcgtacacctcgttcgcgcacgac
ggttcggtcattccggtcaccatgctcaagagcgccgtgcccgccgtgggcgtgcgcgtg
ttctcggccgagaacgcgcacgcggtgcgaaaaatgctgcagatggcggcagcgcccggc
ggcaccggaccgctggcacagactgtgggctactcggtcggcggcaagtcgggcaccgcg
cacaagcaggtcggcaagggttatgcgagcaacaagtaccgcgcgtggttcaccggcatg
gcaccgatcgagaagacccgcatcatcgtcggcgtgatgatcgacgaaccgagcgacggc
gtgtacttcggcggcctggccgccgcgcccgtgttcagcgaagtcgtgcagcaaacgctg
cgcatgatgaacgtgccgccggacctcgcggtcaagccgctggtcacgacgcaaggcgtg
gacgaaagcttctga

DBGET integrated database retrieval system