KEGG   Variovorax sp. PAMC 28711: AX767_07595Help
Entry
AX767_07595       CDS       T04325                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00220  Arginine biosynthesis
vaa01100  Metabolic pathways
vaa01110  Biosynthesis of secondary metabolites
vaa01130  Biosynthesis of antibiotics
vaa01210  2-Oxocarboxylic acid metabolism
vaa01230  Biosynthesis of amino acids
Module
vaa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AX767_07595
Enzymes [BR:vaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     AX767_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AMM26662
UniProt: A0A126ZMM3
LinkDB All DBs
Position
complement(1527417..1528622)
Genome map
AA seq 401 aa AA seqDB search
MLSSRSLEFAQTLVRMNTVSANSNLELIDFVRDHLAGLGVRSRLTYNADKTKANLFATLG
AGKPAGVIISGHTDTVPWDGQDWSIDPLSAMVQDWPQASLREDGEIQRAEARLYGRGAAD
MKSFIAIALANAERFMESTSPFAVHFAFTYDEEVGCFGVRELIADMKDQGVKPLACIIGE
PTNMVPAIAHKGVYRYKCCVRGKEAHSSLTPQSVNAIEMAARVVSRLRDMADGFENSEKR
YEGFDVPFSTASVGQFHGGIADNVVPRDAEFRYEFRNLPTADAQLMQKEVVAYAARAEEA
MKKVAPDAGFSFETICEVPSFLGSAADPVTRLAQRLANEDRTTLVAFGTEAGLFKNAGIP
TVVCGPGSITQAHQPDEYVSLDQLARCELFMHGLANTQEIR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
attctttcctcccgcagcctcgaattcgcgcagacgctcgtgcgcatgaacacggtcagc
gcgaacagcaatctggaactgatcgacttcgtgcgcgaccacctggccggcctcggcgtg
cgcagccgtctcacctacaacgccgacaagaccaaggccaatctcttcgccacgctcggc
gcgggcaagccggccggcgtgatcatttcgggccacaccgacacggtgccctgggacggg
caggactggagcatcgatccgctttcggcgatggtgcaggactggccacaagcctcgttg
cgcgaagacggcgagatccagcgcgccgaggcccgcctgtatggccgcggcgccgccgac
atgaagagcttcatcgcgatcgcactcgccaacgccgagcgcttcatggaaagcacctcg
ccgttcgcggtgcacttcgcgttcacctacgacgaagaagtgggctgcttcggcgtgcgc
gaactcatcgccgacatgaaggaccagggcgtgaagccgctggcctgcatcatcggcgag
cccaccaacatggtgccggccatcgcgcacaaaggcgtgtaccgctacaagtgctgcgtg
cgcggcaaggaggcgcattcgtcgctcacgccgcagtcggtgaatgcgatcgagatggcg
gcgcgcgtggtctcccgccttcgcgacatggccgacggcttcgagaattccgagaagcgc
tacgaaggcttcgacgtgcccttcagcaccgcgagcgtgggccagttccacggcggcatc
gccgacaacgtggtgccgcgcgatgccgagttccgctacgaattccgcaacctgccgacc
gccgacgcccagctcatgcaaaaggaagtcgtcgcctacgccgcgcgcgccgaagaggcc
atgaaaaaggtcgcgcccgacgccggcttcagcttcgagacgatctgcgaagtgccgagc
tttctggggtcggccgccgatccggtcacgcgactcgcgcagcgcctggccaacgaagac
cgcaccacgctcgtcgctttcggcaccgaggccggcctcttcaagaacgccggcatcccg
accgtggtgtgcggccccggcagcatcacgcaggcgcaccagcccgacgaatacgtgtcg
ctcgaccagctcgcgcgctgcgagctgttcatgcacggcctggccaacacgcaagagatt
cgctga

DBGET integrated database retrieval system