KEGG   Variovorax sp. PAMC 28711: AX767_10285Help
Entry
AX767_10285       CDS       T04325                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AX767_10285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vaa02000]
    AX767_10285
Enzymes [BR:vaa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AX767_10285
Transporters [BR:vaa02000]
 Other Transporters
  Pores ion channels [TC:1]
   AX767_10285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N GST_N_3 GST_N_2 GST_C_6 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: AMM24695
UniProt: A0A126ZE46
LinkDB All DBs
Position
2078622..2079230
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALREAGLAFEPVLASTKTHKLDDGTDYYGINPLGYVPLLELDDG
THLREGPAILQYIADQVPLKNLAPANGTLPRYRLQEWLNFIGTEMHKGFSPLFNPATPDD
YKVVVKDKLKSRYTWLDKELAQKEYLMGDTFSVADAYLFTVTNWAGRTGVDLSAFPNVQA
WHARVGARPAVQEALKAEGLNK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtattactcgccgggcgcctgctcgctgtcgccccacatcgcgttgcgcgaa
gccggcctcgccttcgaacccgtgctcgccagcaccaagacccacaagctggacgatggc
accgactactacggcatcaacccgctgggctacgtgccgctgctcgaactggacgacggc
acccacctgcgggaaggcccggccatcctgcagtacatcgccgaccaggtgccgctcaag
aacctcgcgcccgcgaacggcacgctgcctcgctaccgcctgcaggaatggctgaacttc
atcggcaccgaaatgcacaagggtttcagcccgctgttcaaccccgccacgcccgacgac
tacaaggtcgtggtcaaagacaaactcaagtcgcgctatacctggctcgacaaggaactt
gcgcaaaaggagtacctgatgggcgacaccttcagcgtcgccgacgcctacctgttcacg
gtgaccaactgggccggcaggacgggcgtcgacctgtctgcgttcccgaacgtccaagcg
tggcacgcccgcgtgggcgcgcgccccgcggtgcaggaagcgctcaaggccgaaggcctc
aacaagtaa

DBGET integrated database retrieval system