KEGG   Variovorax sp. PAMC 28711: AX767_14310Help
Entry
AX767_14310       CDS       T04325                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AX767_14310 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vaa03400]
    AX767_14310 (ligD)
Enzymes [BR:vaa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AX767_14310 (ligD)
DNA repair and recombination proteins [BR:vaa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AX767_14310 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AMM25401
UniProt: A0A126ZG35
LinkDB All DBs
Position
2939376..2941892
Genome map
AA seq 838 aa AA seqDB search
MAKDDALKTYKAKRNFKITSEPEEGGEAGAEGQRQFVIQKHWATRLHYDLRLELDGTMKS
WAVPKGPSFDPSDKRMAVQVEDHPISYNSFEGQIPAKQYGAGKVIVWDKGTWAPIGDAQK
GYRDGKLKFELHGHKLRGHWTLVRMKGKDRDDAKQPPWLLIKEHDDFERPATEYSVVDAL
PDSVGKRPMPGAKGARKPAAKKSAAKPAGKVALPATLKPQLATLVDAPPADPDAWLYEIK
FDGYRLLARIDGSKVQLFTRNGHDWTHKLGNLAAALQKAKLPPCWLDGEIVVNNAAGVPD
FQALQNAFDKSGTDAIVYFVFDLPFCEGQDLREAPLGARRARLQTLLQDVDSDTVRFSAV
FDAPGRDIVLSACELGLEGVIGKRKDSVYRASRSPDWIKLKCSQRQEFVIGGWTDPKGAR
AGLGALLLGVHDERGALRYAGNVGSGFSAASLTALRQQLDKIAAKKSPFSAKTAIDRSAH
WVAPKLIAEISFSEWTKTGSVRHPVFHGLRADKPPVQIVRERPVDAGSSAKASKAAPKPA
LASVLPASFKVSSPTRVIDATTGATKIDVVRYYALIAPLLLPHLKGRPVSLVRAPEGIGG
ELFFQKHLDKYKMPGVRPLDPALDPGHAPLLEIATAQGLLSAAQMNALEFHTWNAVKTAI
GKPDRMTFDLDPGEGVAWSTMQQAAKLVHVLLKELELAAFVKTSGGKGLHVVVPLQKRDD
WDTVKAFSQAIVQHLARTLPQVFVAKSGPRNRVGKIFADYLRNGFGATTASAWTLRARPG
LGVSVPIAWDEVDHIDSGAHWKLADIHRRLDTGNAPWDGFAEAARSPREAMAALDFTP
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagacgatgcgctgaaaacctacaaggccaaacgaaacttcaagatcacgtcg
gagcctgaagagggcggcgaggcgggtgccgaggggcaacggcagttcgtcatccagaag
cactgggcgacgcggctgcactacgacctgcggctcgaacttgacggcacgatgaagagc
tgggcggtgcccaaaggaccgagtttcgacccgtccgacaagcgcatggcggtgcaggtc
gaagaccatccgatctcgtacaacagcttcgaagggcagatcccggccaagcagtacggc
gcgggcaaggtcatcgtctgggacaagggcacctgggcgccgatcggcgacgcgcagaag
ggctaccgcgacggcaagctcaagttcgaactgcacggacacaagctgcgcggccactgg
acgctggtgcgcatgaagggcaaggacagggacgacgccaaacagccgccctggttgctc
atcaaggagcacgatgacttcgagcgcccggccacggaatacagcgtggtcgacgcgctg
cccgacagcgtcggcaagcggccgatgcccggcgcgaagggggcgcgcaagccggcggcc
aaaaagagcgcggccaagcccgcgggcaaggtcgcgctgcccgccaccctgaagccgcaa
ctggccacgttggtcgacgcgccccccgccgaccccgatgcctggctctacgaaatcaag
ttcgatggctaccggctgctggcccgcatcgacggcagcaaggtgcagctcttcacgcgc
aacgggcacgactggacgcacaagctcggcaacctggcggcggcgctgcaaaaggcgaag
ctgccgccgtgctggctcgacggcgagatcgtggtgaacaacgcggctggcgtgcccgac
ttccaggcgctgcagaacgcgttcgacaaatcaggcaccgatgccatcgtgtacttcgtg
ttcgacctgccgttctgcgagggtcaagacctgcgcgaagcgccgctgggagcgcggcgc
gcgcgactgcaaacgctgctgcaggacgtggacagcgacaccgtgcggttcagcgcggtc
ttcgatgcaccgggccgcgacatcgtgctgtcggcctgcgagctcggcctggaaggcgtg
atcggcaagcggaaggattcggtgtaccgcgcgagccggtcgccggactggatcaagctc
aagtgcagtcagcgacaggagttcgtcatcggcggctggaccgacccgaaaggggcgcgg
gccggtctcggcgcgctgctgctcggcgtgcacgacgagcgcggtgccttgcgctatgcg
ggcaatgtcggcagtggcttcagcgcggcgtcgctcaccgcgctgcgacagcaactcgac
aagattgcggcgaagaagagcccgttttctgcgaagaccgccatcgaccgcagcgcccat
tgggtcgcgccgaagctcattgccgaaatctcgttcagcgaatggacgaagaccggcagc
gtgcggcatccggtgttccatggcctgcgcgccgacaagccgccggttcagatcgtgcgc
gagcggccggtcgatgccggctcgtctgccaaggcgtcgaaggcggcaccgaagccggca
ctcgccagtgtgctgcccgccagcttcaaggtgtcgagcccgacgcgcgtgatcgacgcg
acgaccggcgctaccaagatcgacgtggtgcgctactacgcgctcatcgcgcccctgctg
ttgccgcacctcaagggccgacccgtgtcgctggtgcgcgcacccgaagggattggcggc
gagctctttttccagaagcatctcgacaagtacaagatgcccggcgttcgcccgctcgat
cccgcgctcgatccgggccacgcgccgctgctggaaatcgcgaccgcgcagggcctgctc
tcggccgcacagatgaacgcgctggagttccacacctggaacgccgtcaagacggccatc
ggcaaacccgaccgcatgaccttcgacctggatcccggcgaaggcgtggcctggtcgacc
atgcagcaagccgcgaagctggtgcatgtgctgctgaaagaactggaactggccgccttc
gtcaagaccagtggcggcaagggattgcacgtggtcgtgccgctgcaaaagcgtgacgac
tgggacacggtcaaggccttttcgcaagccatcgtgcagcacctggcgcgcacgctgccg
caagtcttcgtggccaaaagcggcccgcgcaaccgcgtcggcaagatcttcgcggactac
ctgcgcaacggtttcggcgcgaccaccgcgagcgcctggacgctgcgcgcccggccgggg
cttggcgtgtcggtgccgatcgcgtgggacgaggtcgaccacatcgacagcggcgcgcac
tggaagctggccgacatccaccgccgcctcgacacgggcaacgcgccctgggacggcttc
gccgaagccgcgcgcagcccgcgcgaggcgatggcggcgctggatttcacgccctga

DBGET integrated database retrieval system