KEGG   Variovorax sp. PAMC 28711: AX767_15260Help
Entry
AX767_15260       CDS       T04325                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00020  Citrate cycle (TCA cycle)
vaa00190  Oxidative phosphorylation
vaa00650  Butanoate metabolism
vaa01100  Metabolic pathways
vaa01110  Biosynthesis of secondary metabolites
vaa01120  Microbial metabolism in diverse environments
vaa01130  Biosynthesis of antibiotics
vaa01200  Carbon metabolism
Module
vaa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AX767_15260 (sdhB)
   00650 Butanoate metabolism
    AX767_15260 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AX767_15260 (sdhB)
Enzymes [BR:vaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AX767_15260 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AX767_15260 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4_16 Fer4 Fer4_4 Fer2 Fer4_20
Motif
Other DBs
NCBI-ProteinID: AMM25565
UniProt: A0A126ZGJ7
LinkDB All DBs
Position
complement(3148219..3148920)
Genome map
AA seq 233 aa AA seqDB search
MKRTFQIYRYDPDKDAKPYMQTIEIELDGHERMLLDALMKLKAQDPTLSFRRSCREGVCG
SDAMNINGKNGLACLTNMLTLKGTIVLKPLPGLPVIRDLIVDMTQFFKQYNSIKPYLQND
NVPPEKERLQSPEEREELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDEATAERLDNLEDPYRLFRCHTIMNCVDVCPKNLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcacattccagatttaccgctacgacccggacaaggacgccaagccttacatg
cagaccatcgagatcgaactcgacggccacgagcgcatgctgctggacgccttgatgaag
ctcaaggcgcaagacccgacgctgtcgttccgccgctcgtgccgcgagggcgtctgcggc
tccgacgcaatgaacatcaacggcaagaacggtctcgcctgcctgaccaacatgctcacg
ctcaagggcacgatcgtgttgaagccgctgccgggcctgcccgtcatccgcgacctgatc
gttgatatgacgcagttcttcaagcagtacaactcgatcaagccatacctgcagaacgac
aacgtgccgcctgaaaaggaacgcctgcagagccccgaggagcgcgaagagctcgacggc
ctctacgagtgcatcctgtgcgcgagctgctcgaccagctgcccgagcttctggtggaac
ccggacaagttcgttggccccgccggcctgctgcaggcctatcgcttcatcgccgacagc
cgcgacgaagccaccgccgaacgcctggacaatctggaagacccgtatcgcctcttccgc
tgccacacgatcatgaactgcgtcgacgtgtgcccgaagaacctgaacccgaccaaggcg
atcggcaagatcaaggagctcatggtccgccgcgcggtctga

DBGET integrated database retrieval system