KEGG   Variovorax sp. PAMC 28711: AX767_15265Help
Entry
AX767_15265       CDS       T04325                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00020  Citrate cycle (TCA cycle)
vaa00190  Oxidative phosphorylation
vaa00650  Butanoate metabolism
vaa01100  Metabolic pathways
vaa01110  Biosynthesis of secondary metabolites
vaa01120  Microbial metabolism in diverse environments
vaa01130  Biosynthesis of antibiotics
vaa01200  Carbon metabolism
Module
vaa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AX767_15265
   00650 Butanoate metabolism
    AX767_15265
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AX767_15265
Enzymes [BR:vaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AX767_15265
    1.3.5.4  fumarate reductase (quinol)
     AX767_15265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO FAD_binding_3 GIDA HI0933_like Pyr_redox_3 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AMM25566
UniProt: A0A126ZF28
LinkDB All DBs
Position
complement(3148943..3150751)
Genome map
AA seq 602 aa AA seqDB search
MTYTKDQITKRKFDVVIVGAGGSGMRASLQLARAGLNVAVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEYMCREAPKVVYELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQKNVEARTQFFVEWMALDLIRDDEG
DVVGVTALEMETGDLHILQAKTVLLATGGAGRIFQASTNAFINTGDGLGMAARSGIPLQD
MEFWQFHPTGVAGAGVLLTEGCRGEGAILLNSNGERFMERYAPTMKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDYIHMKLDHLGAETIHKRLPSVYEIGINFANVDVTKEPIPVVPTIHYQ
MGGIPTNINGQVVIQKGEENSAVVNGLYAVGECSCVSVHGANRLGTNSLLDLLVFGKAAG
NHIVEFNDKLKEHKALPADAADRSLERLNQLEDSTSGEYAQDVANDIRTVMQQHAAVFRK
QASMDEGVAKIAAMRERVNAITLKDKSKVFNTARIEALEVDNLIEVAQATMVSAAARTEC
RGAHTVEDYERPADDPVAPLGRDDAKWMKHTLWYSEANRLSYKPVQLKPLTVASVPPKVR
TF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacaaaagaccaaatcaccaagcgcaagttcgacgtcgtcatcgtcggcgcc
ggcggctcgggcatgcgtgcctcgctgcaactggcgcgcgccggcctcaacgtggccgtg
ctgtccaaggtgtttccgacgcgctcgcacacggtggccgcgcaaggcggcatcggcgcc
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggt
tccgactggctcggcgaccaggatgcgatcgagtacatgtgccgtgaagcacccaaggtg
gtgtacgagctcgaacatttcggcatgccgttcgaccgcaaccccgacggcacgatctac
cagcgtccgttcggcggccacaccgccaactacggcgaaaagccggtgcagcgcgcttgc
gccgcagccgaccgcaccggtcacgcgatgctgcacacgctctaccagaagaacgtcgag
gctcgcacacagttcttcgtcgaatggatggcactcgacctgatccgcgacgacgaaggc
gacgtggtcggcgtgaccgcgctcgagatggaaaccggcgacctgcacatcctgcaggcc
aagaccgtgctgctggccaccggcggcgccgggcggatcttccaggcttcgaccaatgcc
ttcatcaacaccggcgacggcctggggatggcggcgcgttcgggcatcccgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgctgaccgaa
ggttgccgcggcgaaggcgccatcctgctcaacagcaacggcgagcgcttcatggagcgc
tatgcgccgaccatgaaggacctggcaccgcgcgacttcgtgtcgcgctcgatggaccag
gagatcaaggaaggtcgcggctgcggtcccaacaaggactacatccacatgaagctcgac
cacttgggcgccgagacgatccacaagcgcctgccgtcggtgtacgagatcggcatcaac
ttcgcgaacgtcgacgtcacgaaggaaccgatcccggtcgtgccgaccatccattaccag
atgggtggcatcccgaccaacatcaacggccaggtcgtcatccagaagggtgaagagaac
agcgctgtggtcaacggtctgtatgcggtcggcgaatgctcctgcgtgagcgtgcatggc
gcgaaccgcctgggcaccaactcgctgctcgacctgctggtgttcggcaaggcggccggc
aaccacatcgtcgaattcaacgacaagctcaaagagcacaaggcactgccggccgacgcg
gccgaccgctcgctcgagcgtctgaaccagcttgaagactcgacctcgggcgaatacgcg
caggacgtggccaacgacatccgtaccgtcatgcagcagcacgccgccgtgttccgaaag
caagcgtcgatggacgaaggcgtggccaagatcgccgcgatgcgcgagcgcgtcaacgcg
atcacgctgaaagacaagtccaaggtgttcaacaccgcgcgcatcgaagcgctcgaagtc
gacaacctgatcgaagtggcgcaggccacgatggtgtcggcggcggctcgcacggaatgc
cgcggcgcgcacacggtcgaagactacgagcgcccggccgatgatccggtcgcaccactc
ggccgcgacgacgccaaatggatgaagcacacgctttggtacagcgaagcgaaccgcctg
tcttacaagccggtccagctcaagccgctgactgtcgcctccgtgccgcccaaagtccgc
acgttctga

DBGET integrated database retrieval system