KEGG   Variovorax sp. PAMC 28711: AX767_16945Help
Entry
AX767_16945       CDS       T04325                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vaa  Variovorax sp. PAMC 28711
Brite
KEGG Orthology (KO) [BR:vaa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AX767_16945
Enzymes [BR:vaa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AX767_16945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored Glutaredoxin FAD_binding_3 Thi4 HI0933_like AlaDh_PNT_C FAD_binding_2 DAO FMO-like K_oxygenase Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMM25852
UniProt: A0A126ZK92
LinkDB All DBs
Position
3509655..3511247
Genome map
AA seq 530 aa AA seqDB search
MLDANTKAQLKSYLDRATQPIEIVASIDDSQASDEMRSLLKDVAESSPLVTFTESREDNH
RKPSFSVNRPGENHGPRFAGLPMGHEFTSLILALLQIGGYPPRVEQEVLDQIRALDGDFE
FEIFVSLTCHNCPDVVQALNLMAVQNPRIKTTMIEGGTFQDEVKARQIMAVPTIFLNGTE
FGQGRMSLEEILAKIDTGGVAREAKKIDAKAPFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTMGIENFISVKETVGPAFAIALEEHVRAYDVDIMNLQRAKALVPGKDFV
EIQLESGASLKSRTVVISTGARWRNINVPGEHEFKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVGHVTLIEFDVRLRADEVLQRKLRSLENVTIHTNAQTTEITGDQTV
NGLVYKDRASGELKTVPLEGVFIQIGLVPNTDWLKGTVELSKHGEIVVDARGQTSVPGVF
AAGDATTVPFKQIIIAAGDGAKAALSAFDHLIRTPVPVEVSTPVKEAVAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcaaacaccaaggcccagttgaagagttacctcgatcgcgcgacgcagccg
atcgaaatcgtcgcctcgatcgacgacagccaggcttcggacgaaatgcgttcgctgctg
aaggacgtcgccgagtcgtccccgctggtgacgttcaccgagagccgcgaagacaaccac
cgcaagccgtcgttctcggtcaatcgccccggcgaaaaccacggtccgcgctttgccgga
ttgccgatgggccacgaattcacctcgctcatcctggcgttgctgcagatcggcggctac
ccgcccagggtcgagcaagaagtgctcgaccagatccgcgcgctcgacggcgacttcgaa
ttcgaaatcttcgtgtcgctcacctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgcagaacccgcgcatcaagaccaccatgatcgagggcggcaccttccag
gacgaagtgaaggcgcgccagatcatggctgtgcccaccattttcctgaacggcaccgaa
ttcggtcaggggcgcatgagcctggaagaaatcctcgcaaagatcgatacgggcggtgtc
gcgcgcgaagcgaaaaagatcgatgccaaggcgccgttcgatgtgttgatcgtcggcggt
ggtcccgccggcgcggctgccgcggtgtatgcggcgcgcaagggcatccgcacgggcgtg
gcgtccgagcgttttggcgggcaggtcctcgacaccatgggcatcgagaacttcatctcg
gtcaaggaaaccgtcggtccagccttcgcgatcgctctcgaggagcatgtgcgtgcgtac
gacgtcgacatcatgaatctgcagcgcgccaaggcactggtgccgggcaaggacttcgtg
gaaatccagctcgagagcggcgcttcgctcaagagccgcacggtggtcatttcgaccggt
gcacgctggcgcaacatcaacgtgccgggcgagcacgagttcaagaacaagggcgtagcg
tactgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggccgtcatcggtggc
ggcaactcgggcgtcgaggccgcgatcgacctcgccggcatcgtcggccatgtcacgctg
atcgaattcgacgtgcggttgcgtgccgacgaggtgctgcaacgcaagttgcgcagcctg
gagaacgtgacgatccacacgaacgcgcaaaccaccgagatcaccggcgaccagacggtg
aacggactggtctacaaggaccgtgcgagcggcgaactgaagacggtgcctctcgaaggc
gtgttcatccagatcgggttggtgcccaacaccgactggctcaaaggcacggtcgagctg
tcaaagcacggcgagatcgtggtggacgccagaggccagacttcggtgcccggtgtgttc
gcggcgggcgatgcgacgaccgtgccgttcaagcagatcatcatcgcggctggcgacggt
gccaaggcggcgctgagtgccttcgatcacctcattcgcacgccggtgccggtggaagtg
tcgacgccggtgaaggaagccgtcgcggcctag

DBGET integrated database retrieval system