KEGG   Vibrio alginolyticus: N646_0272Help
Entry
N646_0272         CDS       T02840                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vag  Vibrio alginolyticus
Pathway
vag00250  Alanine, aspartate and glutamate metabolism
vag00410  beta-Alanine metabolism
vag00430  Taurine and hypotaurine metabolism
vag00650  Butanoate metabolism
vag01100  Metabolic pathways
vag01110  Biosynthesis of secondary metabolites
vag01120  Microbial metabolism in diverse environments
vag02024  Quorum sensing
Module
vag_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    N646_0272
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N646_0272
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N646_0272
   00430 Taurine and hypotaurine metabolism
    N646_0272
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    N646_0272
Enzymes [BR:vag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     N646_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS HSCB_C FAD-SLDH Aminotran_1_2 AAA_33
Motif
Other DBs
NCBI-ProteinID: AGV16105
UniProt: A0A2I3BZ59
LinkDB All DBs
Position
1:complement(303365..305011)
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIDESLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSSPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQNDTFYNQWMHSANHSLGAFCSGGTIANITA
LWVARNKALRANGSFKGVEKEGLFKAMMHYGYDGLAVLVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVNDLKAKIVELEKQNIKPIAVIGVAGTTETGNVDPLPEIAEVCQAHG
CHFHVDAAWGGATLMSNHHRHLLKGVEMADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYLPPFIREALAQAEGSQKEQLNELINELTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTKEILSSVLDEQREIAKQAPNLMKRIQQ
LVVDIQSS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgatgttagctttgagagcttgctaaagatcttcact
gtcccagaaggtccggactcaacgttaactaaaattgacgagagcctctcgcgaaatcta
aatcaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgcgaaatcgaaaaa
gacttttcttctgctcagattcctgagcagccagagttcgtgtcagatcatacagagcac
ttactcgacactttggtgtcgcactcagttcacacatcttcaccaagcttcattggtcat
atgacatcggcactgccttatttcttgatgccactgtcaaagatcatgatcgccttaaac
caaaacctggtaaaaatagagacttccaaagcctttacgccacttgagcgtcaagttttg
ggtatgctgcatcgcttaatatatggtcagaatgatacgttttacaatcagtggatgcac
agtgcaaaccactcattaggcgcattttgttccggcggcaccattgccaatatcactgcg
ctttgggtagcacgtaacaaagcgttaagagccaatggctcatttaaaggcgttgagaag
gaaggcctttttaaagccatgatgcactatggatatgatggcttagcggtgctagtgtct
gagcgtggtcactactcccttaagaaagcagccgatgtattagggctaggccaagagggc
ttggttgcggttaaaaccgatgccaacaaccgtattattgtcaacgacctgaaagcgaaa
attgttgagctcgaaaaacaaaatatcaagcctattgctgttattggtgtggctggcaca
acagagacaggtaatgttgatccattgcctgaaatcgctgaagtctgccaagctcacggc
tgtcacttccatgtggatgccgcatggggtggcgcaacacttatgtctaaccatcaccgt
caccttctcaaaggtgtggaaatggcagactcagtaactattgatgcgcataagcagctc
tacatcccgatgggcgctggtatggttctgttcaaagaccctgacgcaatgaaatccata
gagcatcacgctcaatatatattgcgcaaaggttcaaaagacctaggcagccatacatta
gaaggttcacgttcgggtatggcgatgttggtctacgccgcaatgcacatcataagtcgc
ccaggttacgagcttctgattgaccaaagcattgaaaaagctcgatactttgcggattta
atcaaacagcaagatgatttcgagttagtttctgaaccagagctttgtctgctcacatac
cgttatttgccgccattcatccgtgaagcattagcacaagcagaaggctcacaaaaagaa
caactgaatgagctgatcaatgagttaacacagtttattcaaaagcgtcagcgcgaaacg
ggcaaatcgttcgtttcacgtacaagactgaacccagaccaatggcaacgcatgaatacg
atagtgtttagagtggttttggcaaatccactgaccacaaaagaaattttgagctcagtg
cttgatgaacaacgcgaaatcgccaagcaagcaccaaatttgatgaaaagaattcaacag
ctggttgtcgatattcaatcgtcttaa

DBGET integrated database retrieval system