KEGG   Vibrio alginolyticus: N646_1237Help
Entry
N646_1237         CDS       T02840                                 

Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vag  Vibrio alginolyticus
Brite
Enzymes [BR:vag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     N646_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGV17070
UniProt: A0A2I3C845
LinkDB All DBs
Position
1:1324632..1325216
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcgaaagacgcactagaaccacacatctca
gcagagactctagactaccaccacggtaagcaccacaacacttacgttgttaagcttaac
ggtcttatccctggtactgagttcgaaggcaaaactctagaagagatcatcaagacttct
actggtggcgtattcaacaacgcagcgcaaatctggaaccacacgttctactggcactgt
cttgctccaaatgcgggcggcgagccaactggcgcagttgcagacgcaatcaacgcagca
ttcggttcttttgaagaattcaaagcgaagtttactgattcagcaatcaacaacttcggt
tcttcatggacttggcttgttaagaaagctgatggctctctagagatcgttaacacttct
aacgctgctactcctctaacagaagaaggtacaacaccacttctaactgttgacctatgg
gaacacgcgtactacatcgattaccgcaacgtacgtcctgattacatgaacggcttctgg
gctctagtaaactgggacttcgtagctgagaacctagcgaagtaa

DBGET integrated database retrieval system