KEGG   Vibrio alginolyticus: N646_1310Help
Entry
N646_1310         CDS       T02840                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vag  Vibrio alginolyticus
Pathway
vag00071  Fatty acid degradation
vag00280  Valine, leucine and isoleucine degradation
vag00281  Geraniol degradation
vag00310  Lysine degradation
vag00362  Benzoate degradation
vag00380  Tryptophan metabolism
vag00410  beta-Alanine metabolism
vag00640  Propanoate metabolism
vag00650  Butanoate metabolism
vag00903  Limonene and pinene degradation
vag00930  Caprolactam degradation
vag01100  Metabolic pathways
vag01110  Biosynthesis of secondary metabolites
vag01120  Microbial metabolism in diverse environments
vag01130  Biosynthesis of antibiotics
vag01200  Carbon metabolism
vag01212  Fatty acid metabolism
Module
vag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    N646_1310
   00650 Butanoate metabolism
    N646_1310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N646_1310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N646_1310
   00310 Lysine degradation
    N646_1310
   00380 Tryptophan metabolism
    N646_1310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    N646_1310
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    N646_1310
   00281 Geraniol degradation
    N646_1310
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N646_1310
   00930 Caprolactam degradation
    N646_1310
Enzymes [BR:vag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     N646_1310
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     N646_1310
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     N646_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGV17143
UniProt: A0A2I3C853
LinkDB All DBs
Position
1:complement(1402078..1404189)
Genome map
AA seq 703 aa AA seqDB search
MSEQKAFSLKVDEQNIAWLAIDVPNEKMNTLQAAFADEMKEIFAQLKDSSGIKGMIIHSL
KPDNFVAGADVRMLEACTTASEAEALARQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDYRVCTDSDKTRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPDTILFDVAKQFIDKGKNKGTKKLSTKEKVMSGSGLGRKFVFEQAAKKTNQ
KTRGNYPATVAILEVIQHGLEKGFAKGQELEAKRFGELVMSSESKALRSIFFATTEMKKE
NGTDAKPAPVHKVGVLGGGLMGAGISHVSVAKAKVPVRIKDVSNDGVLNALNYNYKLFEK
QRKRRILSKADLQAKMLQLSGGVDFTSFNHIDVVIEAVFEDLDLKQKMVADIEANAKTET
IFATNTSSLPIHKIAEKAERPENVVGLHYFSPVEKMPLVEVIPHETTSDETVSTVVALAK
KQGKTPIVVKDKAGFYVNRILAPYMNEAAHILLANEPIEKIDTALLDFGFPVGPITLLDE
VGVDIGAKIMPILVNELGDRFKGPDVFDILLNDGRKGRKSGKGFYTYKGKKKDVDKSVYK
LLKLDPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQFGIKELVEKMNELASKYGDRYAPCDGLLTRAGEGTTFY
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaaaagcatttagtctaaaggttgatgagcaaaatattgcttggttagcc
atcgatgttcctaatgaaaaaatgaatacgctgcaggcggcttttgctgacgaaatgaaa
gaaatttttgctcagctaaaagactccagtggtattaaagggatgatcatccactcccta
aaaccggacaattttgttgcgggcgcagatgttagaatgctagaagcatgcaccacagca
agtgaagcggaagccttagcaaggcagggtcaggagttgttccagcagctatcggactta
ccttatcctgtcgttgcggctattcatggcccatgtttgggcggtggtttagaactggct
cttgcatgtgattatcgtgtttgtacggattctgacaaaacgcgtttaggtctgccagaa
gtacaacttggtttattgccaggttctggtggtactcagcgtctgccacgtttgattggc
ctgttaccgtcgttggacttgatcctgacgggtaaacaacttcgtgcgaagaaagctaaa
aaactgggcgttgtggacgcctgtgtgccggacaccattttgttcgacgtagcaaaacag
tttatcgacaaaggtaaaaacaagggtacgaaaaagctatcgacgaaagaaaaggtgatg
tctggtagcgggctagggcgcaagtttgtatttgagcaagctgcgaagaaaacgaatcaa
aaaacccgtggtaactatccagcaacggttgcaattctagaagttattcaacatggctta
gagaaaggcttcgctaaaggccaagaacttgaagcgaagcgcttcggtgagcttgtaatg
agctcagagtcaaaagcgctccgttcgatcttctttgccacaacagaaatgaagaaagaa
aatggcacggatgcgaaaccagcaccagttcataaagttggtgtgcttggtggtggtctg
atgggcgccggaatcagccatgtgtctgttgcaaaagcaaaagtacctgttcgcatcaaa
gacgttagcaacgatggcgttttaaacgcgctcaactacaactacaagttatttgagaaa
cagcgcaaacgtcgcattctatccaaggccgacctgcaagcgaaaatgctgcaactgtct
ggtggtgtcgactttaccagttttaatcatattgatgtcgtaattgaagccgtttttgaa
gacctagatcttaagcaaaaaatggtggcggacattgaagcgaacgctaagacagaaact
atctttgcgaccaatacttcttcgttgcctatccacaaaattgcagaaaaagcggagcgt
ccagaaaacgtagtgggtttgcattacttcagcccggtagaaaaaatgccgttggtggaa
gtgattccgcatgaaacgacgtcagatgaaaccgtttcaacagttgttgcacttgctaag
aagcaaggtaaaaccccgatcgtagtgaaagacaaagcgggcttttacgtgaaccgcatt
cttgctccatacatgaacgaagcggcgcatattttgttggctaacgaaccgatcgaaaag
attgatacggcgttgcttgattttggtttccctgttggcccgattaccttgttggatgaa
gttggtgtcgacattggcgcgaaaattatgccgatcctggttaatgagttaggtgaccga
ttcaaagggccggatgtgtttgatatcttgttaaatgatggacgtaaaggacgcaagagt
ggtaaggggttttacacttataagggcaagaagaaagatgtcgacaaatcggtttacaaa
ctgcttaagctcgaccctgaatctaagctaagcgataacgatattgcgttgcgctgtgtg
ctgccaatgctgaatgaagcggtacgttgtttggatgatggcatcattcgctcgccacgt
gacggtgatattggcgcgatatttggtattggtttcccaccgttcttgggtggcccgttc
cgttacatggaccaatttggtattaaggagctcgtagagaaaatgaatgagcttgcatcg
aaatatggcgatcgttacgcgccatgtgatggtttgcttactcgagctggtgaagggaca
acgttctattaa

DBGET integrated database retrieval system