KEGG   Vibrio alginolyticus: N646_2609Help
Entry
N646_2609         CDS       T02840                                 

Definition
(GenBank) penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
vag  Vibrio alginolyticus
Pathway
vag00550  Peptidoglycan biosynthesis
vag01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N646_2609
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    N646_2609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vag01011]
    N646_2609
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vag03036]
    N646_2609
Enzymes [BR:vag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N646_2609
Peptidoglycan biosynthesis and degradation proteins [BR:vag01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   N646_2609
Chromosome and associated proteins [BR:vag03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    N646_2609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AGV18421
UniProt: A0A2I3CEL6
LinkDB All DBs
Position
1:2805750..2807543
Genome map
AA seq 597 aa AA seqDB search
MIRKKSNTKQANKRKPVAKEKAATGDKKNDNKAVKVAVEESFLIRWRFHLLLFFVFCAFA
LLVARVAYIQIIEPDNLIKQGDLRSVRVKSIPSARGIISDRNGEPLAVSVPVEAVWADPA
TIFKENALSQTKSWHALADVLGIDRQGLIDKIKRNEKRRFIYLQRQVSPAMANYIRELKL
PGVGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDEWLTGAAGKKTIRKDRYGR
VVENIAWQDKQEGKSLQLTIDQRLQAIAYRAIKQAVADHRATSGSVVMLDVKTGAVLAMV
NAPSYNPNNRSDWQSYQMRNRVITDSMEPGSTIKPFVILAALENGIADKDTIVDTGNGVL
RLGGSRVRDVSRVGKASLTTILKKSSNIGVTKLAMQMLVEALLGLYSSVGFGELSGLNLV
GEVTGIFPTRTRWSPIERATIAFGYGLSITPIQLAHAYATLGNLGKYEPIHIIESNDHDM
SRQVVSAKYARQVLDMLETVTQKGGSARRAAVPGYRVGAKTGTSRKASAGGYSDEYITYT
AGLAPVSDPRIALVVIVNEPQGDDYYGGSVASPVFSEIMKGALQILNVAPDENKFQQ
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaaaaaatccaacacgaaacaagccaataagcgtaaacctgtagcaaaagag
aaagcggctacgggggataagaaaaacgataacaaagcagtgaaagtggcggtcgaagaa
tctttcttgattcgttggcgcttccatctattactgttttttgttttttgtgcatttgcc
cttttggtggcacgcgtagcctacatccaaatcattgagccagataacctgattaaacaa
ggtgacctacgttcggttcgtgttaaatccattccttctgctcgcggtattatttcggat
cgaaatggtgagccgcttgctgtcagtgtaccggttgaggctgtttgggcagatcctgcc
acgatttttaaagaaaacgcgttaagccagaccaaaagttggcatgcattagcggatgtt
cttggtattgaccgacaagggttaatagacaaaatcaagcgcaatgaaaaacgccgcttt
atctacttgcagcgccaggtcagtccggccatggcgaactatattcgtgagctaaagctg
ccaggtgttggccttaagtcggaatctcgtcgttattatcctgcaggtgaggttagtgct
cacttagtcggtgtgacaggcattgacgggcatggcctagaaggtgtggagcgtagctac
gatgagtggctcactggcgcggcgggtaagaaaactattcgtaaagaccgttatggtcgt
gttgtggaaaacattgcttggcaagacaagcaagaaggtaaatcacttcagttaaccatc
gatcagcgcctacaggcgattgcgtatcgtgcgattaagcaagccgttgcggaccaccgc
gccacttcaggttctgttgtcatgttggatgtaaaaacgggcgccgtattggccatggtt
aatgctccttcttacaaccctaacaatcgtagcgattggcaaagctatcaaatgcgtaac
cgagtgatcacggactcaatggagcccggttcgaccattaagcctttcgttattttagcc
gccttagaaaatgggatagcggataaagataccatcgtagataccggtaatggtgttcta
cgtttaggtggtagtcgagtcagagatgtctctcgcgtaggtaaagcgagcttgaccacg
atccttaaaaagtcgagtaatatcggtgtgacgaagctagcaatgcaaatgctggtagag
gcgcttcttgggctgtacagttcagtgggttttggtgagctttctggcctaaacctagtt
ggggaagtgacgggtatttttcctacacgaactcgttggtcgccaattgagcgcgccacg
attgcgtttggttatggtctatcaattacaccaatccagctagcccatgcttatgcgacg
cttggaaaccttggcaaatacgagcctattcatattatcgaaagcaatgatcatgacatg
tcacgccaagtggtgagtgcgaagtatgcgcgtcaagtattagacatgttggaaaccgta
actcaaaaagggggctcggctcgcagagcggcagttcctggttatcgagtaggagcgaaa
acgggtacatcacgtaaagcttctgccggtgggtacagcgacgagtacatcacctacacg
gctgggcttgctccggttagcgatccgcgaattgctttagtagtgatcgtaaacgagcct
caaggcgatgactactatggtggttcggtagcgtctcctgtcttctctgaaatcatgaaa
ggcgcgctacaaatactcaatgttgcacctgacgaaaacaaattccaacagtaa

DBGET integrated database retrieval system