KEGG   Vibrio alginolyticus: N646_3077Help
Entry
N646_3077         CDS       T02840                                 

Definition
(GenBank) hypothetical protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vag  Vibrio alginolyticus
Pathway
vag00220  Arginine biosynthesis
vag00250  Alanine, aspartate and glutamate metabolism
vag00290  Valine, leucine and isoleucine biosynthesis
vag01100  Metabolic pathways
vag01110  Biosynthesis of secondary metabolites
vag01130  Biosynthesis of antibiotics
vag01210  2-Oxocarboxylic acid metabolism
vag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N646_3077
   00290 Valine, leucine and isoleucine biosynthesis
    N646_3077
   00220 Arginine biosynthesis
    N646_3077
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vag01007]
    N646_3077
Enzymes [BR:vag01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     N646_3077
    2.6.1.66  valine---pyruvate transaminase
     N646_3077
Amino acid related enzymes [BR:vag01007]
 Aminotransferase (transaminase)
  Class I
   N646_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGV18887
UniProt: A0A2I3CGK5
LinkDB All DBs
Position
1:complement(3333036..3334250)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLIPAPDYPLWTASVALSGGKPVHYLCDEEADWYPDLEDIKKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLIIFADEIYDKVLYDGATHTSVATLTEDVLVMTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYVNGLELLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRNRAYELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKNDQQMVLDFLKQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctacgacattaggggtcct
gtactcaaacatgctaagcgcatggaggaagaagggcataaaatcctaaagctaaacatt
ggtaaccctgccccatttggttttgacgcccctgatgagattttagtcgacgtgattcgt
aatctgccgacttctcaaggctattgtgattccaaaggtatttactctgctcgtaaagct
gtggtccaacactatcagcgtaaaggtatacgctcgctagatgtcgaagatgtgtatgta
ggtaacggcgtgtctgagttgatcgtaatggccatgcaagcgctattaaacaatggcgac
gaaatgctgatcccagcaccagactatccgttatggacagcttcagttgcactatctggt
ggtaagccggttcattatctatgtgatgaagaagctgactggtacccagaccttgaagac
atcaaaaagaaaatcacaccaaagacacgtggcattgttctgatcaacccgaacaacccg
acaggtgcggtatacagccgtgacttcctacttgaagtgattgagatagcacgccagcac
aaactgatcattttcgcagatgagatctacgacaaagtgttgtacgacggtgcaacacat
acctcagtcgccacactcactgaagacgtgctagtcatgacattcaatggcctttcaaaa
gcctaccgtgtttgtggtttccgtggtggctggatgttcttaacggggcctaaacatctg
gctcaagggtacgtgaatggcttggagctgctttcatcgatgcgtttatgtgcaaacgta
ccaatgcaacatgccattcaaaccgcgttaggtggataccagagtatcaatgaactgatt
ttacctggcggacgcttgttagagcagcgcaaccgagcgtatgaactgatcaatcagatt
cctggcgtttcttgtgtcaaacctaagggtgcgatgtacctcttcccgaaaatcgacact
aaaatgtacaacatcaagaacgatcaacagatggttttagatttcttaaaacaagagaaa
gtcttactggtgcaaggttccggctttaactggccaaaaccagaccacttccgcatcgtg
acactaccgcacgttgaagatctagaaatcgccattggacgttttgaaagattcctatca
acctacagccagtaa

DBGET integrated database retrieval system