KEGG   Vibrio alginolyticus: N646_3413Help
Entry
N646_3413         CDS       T02840                                 

Definition
(GenBank) alkyl hydroperoxide reductase, subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vag  Vibrio alginolyticus
Brite
KEGG Orthology (KO) [BR:vag00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    N646_3413
Enzymes [BR:vag01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     N646_3413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like FAD_binding_3 Thi4 Thioredoxin_9 Chalcone_N DUF5474 DAO NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AGV19223
UniProt: A0A2I3CL77
LinkDB All DBs
Position
2:372284..373852
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEEVRLVVSLDESKASNDILSLANQIAEMSDLITVERDDNASA
RKPVMAVTNPAKGTALRFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKDLD
VEIFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGALFQDEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDGASEKAAKALSEKDPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAEKLMGATHTE
DGLIHIQLESGATLKSKSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKANSLPNVDIITMAQTTEVVG
DGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGDT
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagaa
gttcgtttagtggttagtctagatgaaagcaaagcatcgaatgacattttgtctctagcg
aaccaaatcgcagagatgagcgacctaatcaccgttgaacgtgacgacaacgcaagcgca
cgtaaaccagtgatggcggtaactaacccagcaaaaggcacagcactacgctttgcaggc
ttgccaatgggtcacgaatttacctctctagtattggcactgcttcactctggcggtcac
ccaatcaaactagaaccagaagtgattgagcaaatcgcagcactagacaaagatctagac
gtagaaatcttcatttcactgtcgtgtcaaaactgtccggacgtggttcaagcgttcaac
atgatggcggcgatcaacccgaaagtaaaagcaaccatgatcgacggtgcactcttccaa
gatgaagtgaaacaacgcgacatcatggccgtaccaagcgtattcgtgaacggtgagcta
ttcggtcaaggccgtatgtctctgactgaaatcctaaacaaagtggatgacggcgcgagc
gagaaagccgcgaaagcactgagcgaaaaagacccatacgatgtacttgttgtcggcggt
ggtcctggtggtagcgcagctgcactatacgctgctcgtaaaggtattcgtactggcgtt
gttgctaaacgctttggtggtcaggttatggacaccatggcaatcgagaacttcatttcg
gtgaaacgcactgaaggtccaaaactagcaactgacctagcagaacacctaaaagaatac
gacgtagacgtcgtgactgagcaacaagctgagaagctaatgggtgcaacacacacagaa
gacggcttgattcacatccaacttgaaagcggcgcaacgctgaagagtaagagtgtcatc
cttagccctggtgcacgctggcgtgaaatgaacgttccgggtgagcaagagtaccgcaac
aaaggcgtcgcgtactgcccacactgtgacggtccactgttcaaaggcaaaaaaactgcg
gttatcggtggtggtaactcaggcatcgaagcagctatcgaccttgctggtatcgtagaa
cacgtaacggttcttgaattcgcagacgtacttcgcgcagaccaagtgcttatcgacaaa
gcgaactcactaccaaacgtagacatcatcacgatggcacaaactacagaagtggtgggt
gacggtactcgcgtaacaagcttgaagtacaaagaccgcaacacagatgaaatcaaagag
attgaactgtcaggtatctttgttcaaatcggtctagtaccgaacacagaatggctaaaa
gattcagaagtagcgctatctgagcgcggcgaaatcgaagtcggtagccgtggcgatact
agcctagaaggtgtgttcgcagcgggtgacgcaacaaccgttccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcatttgactacctaatccgtaag
caaggctaa

DBGET integrated database retrieval system