KEGG   Vibrio alginolyticus: N646_4376Help
Entry
N646_4376         CDS       T02840                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vag  Vibrio alginolyticus
Pathway
vag00473  D-Alanine metabolism
vag01100  Metabolic pathways
vag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N646_4376
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    N646_4376
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vag01011]
    N646_4376
Enzymes [BR:vag01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     N646_4376
Peptidoglycan biosynthesis and degradation proteins [BR:vag01011]
 Precursor biosynthesis
  Racemase
   N646_4376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Virul_Fac
Motif
Other DBs
NCBI-ProteinID: AGV20185
UniProt: A0A2I3CSB2
LinkDB All DBs
Position
2:1415338..1416567
Genome map
AA seq 409 aa AA seqDB search
MRLNKTLLSLTIAAAIAAPVMQATAAPLQISNTAAKAEQVQGANAWLEINLGQFRDNIEQ
FKSHMDGKTKICAVMKADAYGNGIAGLMPTIIEQQIPCVAVASNAEAQTVRDSGFKGQLM
RVRSADIGEIEAAIDLNVEELIGTAEQAKALSKLAEKAGKEIKAHLALNDGGMGRNGVDM
TTEAGKKEALKIAQQAGVNIVGIMTHFPNYNADDVRQKLASFKDSSAWLIKEANLKRDNI
LLHVANSYTALNVPEAQLDMVRPGGVLYGDLPTNPEYPSIVSFKTRVASVHHLPKNSTVG
YDSSYTTSKESLMANIPVGYSDGYPRKMGNTAEVLINGQRAKVAGVASMNTTMVDVTGIK
DVEPGSEVVLFGSQQGKTISATEMEKHAEVIFPELYTVWGSANPRVYVK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttaaataaaaccttactatcactgactatcgctgctgcaatcgcggctcctgta
atgcaagctactgctgctcctcttcaaattagcaatacagcagcaaaagcagagcaagtt
caaggtgctaacgcttggctagaaataaacttaggtcagttccgcgataatattgagcag
tttaaatcgcacatggatggcaaaacgaaaatctgcgccgtgatgaaagccgacgcatac
ggtaatggtatcgcaggcctgatgccgactattatcgaacaacaaattccttgcgttgcc
gttgcaagtaacgccgaagcacaaactgttcgcgacagtggctttaaaggccaacttatg
cgtgtacgctcagcggatattggcgagattgaagccgcaatcgacctaaatgtcgaagag
ttgataggcacagcagagcaagctaaagcactgtctaaactagccgagaaagctggtaaa
gaaatcaaagctcaccttgctctgaacgacggtggtatgggacgtaatggtgttgatatg
acgacagaagcgggcaagaaagaagcgctaaaaatcgctcaacaagctggcgtaaatatt
gttggtatcatgactcatttccctaactacaatgcagacgacgtgcgccaaaagttagct
tcattcaaagacagttctgcatggctgattaaagaagcgaatctaaaacgcgacaacatt
ttactgcacgtagcaaactcttacaccgcgcttaatgttcctgaggcgcagcttgatatg
gttcgtcctggtggcgttttatacggagacttaccaactaaccctgagtacccttctatc
gtgtctttcaaaacacgcgtggcatccgttcaccacctgccaaaaaatagcacagtcggt
tacgacagcagctacacaacaagcaaagaaagcttaatggcgaacattcctgttggttac
tctgatggttatccacgaaaaatggggaatacggcagaagttctgatcaatggccaacgt
gcaaaagttgcgggcgttgcttcaatgaacactactatggtagatgttacaggtatcaaa
gatgttgagcctggttctgaagttgttttgtttggctcccaacaaggcaaaacgatttca
gctactgagatggaaaaacacgcagaagtcatcttccctgaactatacacggtttgggga
agcgcgaaccctcgtgtctacgtaaaataa

DBGET integrated database retrieval system