KEGG   Vampirococcus sp. LiM: BU251_00500Help
Entry
BU251_00500       CDS       T05804                                 

Definition
(GenBank) thioredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vai  Vampirococcus sp. LiM
Brite
KEGG Orthology (KO) [BR:vai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BU251_00500
Enzymes [BR:vai01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BU251_00500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored FAD_binding_2 HI0933_like GIDA NAD_binding_8 K_oxygenase Thi4 AlaDh_PNT_C DAO FMO-like NAD_binding_7 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QAT16325
UniProt: A0A410P2A6
LinkDB All DBs
Position
213814..214728
Genome map
AA seq 304 aa AA seqDB search
MLDLVIIGAGPAGITAAIYAARKKIDFVLVSEDLGGQTALSADVENYTGYQFITGPDLAA
KFEEHLRQFAITFYNGEAVTRIAWQAEGAGGGFAVESAKASYACRSVLIASGRRPRWLGV
PGEEKFRNKGVSYCATCDGPLFSKKTVAVIGGGNSALDAALQMVNIAEKVYLVDINAALG
GDEIMRRKVQVSPRVEVLNNAKTVEIAGDRFVTSLKVEVSGKPRELAVSGIFVEIGSIPN
SEIADFVDRNDAGEIVVDCLNRTSVRGVFAAGDVTTVPEKQIIVAAGEGAKAVLGVSRYL
MQEK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcttgtcattatcggcgcaggcccggcggggattacggctgcgatttatgcc
gcccgtaaaaaaatcgactttgtccttgtgtctgaggacttgggcggccagacggccttg
agcgccgatgtggagaattataccggctatcagttcatcacaggaccggacctggcggcc
aagttcgaagagcatctgcgtcaattcgccatcaccttttataacggcgaagcggtgacg
cggattgcctggcaggccgaaggggccggcggcgggtttgccgtcgaaagcgccaaggcc
tcttatgcgtgccgttccgtgttgatcgcctcggggcgccggccccggtggctgggagtg
cccggcgaagagaaatttcgcaacaagggcgtcagttactgtgcgacatgcgacgggccg
ctgttttccaaaaagacggtggcggtcatcggcggcggcaactcggccctggatgcggcg
ctgcagatggtgaatatcgccgagaaggtatatctcgtcgatatcaatgccgcgctcggc
ggcgacgagatcatgcgccgcaaggttcaggtatcgccgagggtcgaggttttgaataac
gcaaagacagtggagatcgcgggcgatcgttttgtcacatctctgaaggttgaagtttcg
ggaaagccgcgggaactggctgtgagcggtatcttcgtggagatcggttcgattcccaac
agcgagattgcggattttgtggacaggaatgatgccggtgagatcgtcgtcgattgcctc
aacaggaccagtgttcggggcgtctttgccgccggcgacgtcacaaccgtgcctgagaag
cagatcatcgtggccgccggcgaaggcgccaaggcggtcttgggtgtttcccgctacttg
atgcaggaaaaatga

DBGET integrated database retrieval system