KEGG   Verticillium alfalfae: VDBG_00799Help
Entry
VDBG_00799        CDS       T02227                                 

Definition
(RefSeq) glucoamylase P
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
val  Verticillium alfalfae
Pathway
val00500  Starch and sucrose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDBG_00799
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     VDBG_00799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 AvrPto
Motif
Other DBs
NCBI-GeneID: 9530691
NCBI-ProteinID: XP_003009117
UniProt: C9S7A6
LinkDB All DBs
AA seq 622 aa AA seqDB search
MVSLRSQLLALAAALAIPAVSGQDLEDFIAKQRPLSLTNVLNNLGAAAGAAPGLVIASPS
KTDPPYYYTWTRDSALTFKMLIDEFIHDPVANANLEKHIRDYLRAQAILQTVANPSGALL
PSGRGLGEAKYEVDGSRFNGAWGRPQRDGPPLRAVALITWANWLADSGDEGEEEARDIVW
PVIANDLAYTGQYWNSTGFDLWEEVSGSSFFTTQAQYRALIEGAELAERLNTTCGAACDE
APAVGCFLNSDSYWNGRHHIANINTNTQRSGKDANTMLGANAAFDIAASCDSATIQPCHP
RALASFKQWVDAWRDPAEYPINEGIPSNEGIAIGRYTEDIYYNGNPWYLITLGAGEFLFN
AAHQWKAHGYITIDSTSLPFFQDLCPEAKVGTFKRPCSKNPKAPFNVIVEAANRYGDSFL
AVAQKYTPADGSLAEQYNRDPPFEPQSARDLTWSYAAFVTAAARRAGEFPPTWVPANLPI
PSTCAASSARGTYAPATAAGAPDLGEVPCAAPVTFRVDARTYYGEDIYVVGGAPSLGNWN
VENAQPLTADGYTDARPLWAIDVDLDAAGQTVTYQFVRRQNCGQGYIYETVNRTVDVPAC
GVTTPTVLEATWTGPVGTPGNC
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggtctctctccgctcccagcttctggccctggccgctgccctggccatccccgccgtc
tctggccaggacctcgaggacttcatcgccaagcagcgccctctgtcactgaccaatgtt
ctcaacaaccttggtgccgctgccggcgccgcccccggcctggtcatcgcaagcccctcc
aagaccgaccctccctactactacacttggacccgtgactcggccttgaccttcaagatg
ctcatcgacgagttcatccacgaccctgtcgccaacgccaacctcgagaagcacattcgt
gactaccttcgcgcccaggccatcctccagactgtcgccaacccctccggcgccctgctg
ccctccggccgcggtctcggcgaggctaagtacgaggttgacggctcacgcttcaatggc
gcctggggtcgcccacagagggatggacctcctctgcgcgccgtcgccctcatcacctgg
gccaactggctcgccgattcgggcgacgagggcgaggaagaggcgagggacatcgtctgg
cccgtcattgccaacgatctcgcctacactggacagtactggaactcaaccggcttcgac
ctctgggaggaggtctccggctccagcttcttcaccacccaggctcagtaccgcgctctg
atcgagggtgccgagctcgctgagcgcctcaacacgacgtgcggcgccgcctgcgacgag
gcccctgccgtcggctgcttcctcaactcagacagctactggaacggccgtcaccacatt
gccaacatcaacaccaacacccagcgctccggaaaggacgccaacaccatgctcggcgcc
aacgccgcctttgatattgccgcctcctgcgacagtgccaccattcagccctgccaccct
cgcgccctggcgtctttcaagcagtgggttgacgcctggcgtgatcctgccgaatacccc
atcaacgagggtatccccagcaacgagggcattgccatcggccgctacactgaggacatc
tactacaacggcaacccttggtacctcatcactcttggtgctggcgagttccttttcaac
gccgcccaccagtggaaggcccacggctacatcaccattgacagcacctccctgcccttc
ttccaggatctctgtcccgaggccaaggttggtaccttcaagcgcccctgctccaagaac
cccaaggctcccttcaacgtcattgtcgaagctgccaaccgctacggcgattcgttcctc
gccgtcgctcaaaagtacaccccggccgacggctccctcgccgagcagtacaaccgtgac
cctcccttcgagccccagagcgcccgcgacctgacctggtcctacgccgcctttgtcacc
gccgccgcccgccgcgccggcgagttccctcccacttgggtccctgccaacctgcccatc
ccctcgacctgcgccgcctcgtccgcgcggggcacctatgcccctgccaccgccgctggt
gcgcccgaccttggcgaggtcccctgcgctgcgcccgtcaccttccgtgtcgacgccagg
acctactacggcgaggacatctacgtcgtcggcggtgcgccgtctctcggcaactggaac
gtcgagaacgcccagcccctgaccgccgacggctacaccgacgcccggccgctctgggcc
attgacgtcgacctcgacgccgcgggccagaccgtcacctaccagtttgtgcgcaggcaa
aactgcggccaaggctacatttacgagacggtcaacaggaccgtcgacgtgccggcgtgc
ggtgtcacgacgccgaccgtcctcgaggccacgtggactggccccgtgggtacacccgga
aattgctag

DBGET integrated database retrieval system