KEGG   Verticillium alfalfae: VDBG_01940Help
Entry
VDBG_01940        CDS       T02227                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
val  Verticillium alfalfae
Pathway
val00040  Pentose and glucuronate interconversions
val00051  Fructose and mannose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VDBG_01940
   00051 Fructose and mannose metabolism
    VDBG_01940
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     VDBG_01940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C AlaDh_PNT_C 3HCDH_N YdfZ UDPG_MGDP_dh_N HI0933_like TrkA_N
Motif
Other DBs
NCBI-GeneID: 9535380
NCBI-ProteinID: XP_003007752
UniProt: C9SBU7
LinkDB All DBs
AA seq 378 aa AA seqDB search
MSDSKVQASVLHGAKDLRVEDRDLPAPSADEVQIAVEATGLCGSDLHYYSHYRNGDIIVC
EPLTLGHESAGTVTAVGSAVTSLAAGDRVALEVGLPCGSCDLCAQGRYNICPGMKFRSSA
KANPHAQGTLQERVNHPAKWVHKLPDAVSLELGALVEPLSVAMHARNRANLPSGSTVLVL
GAGAVGLLVAAVSKAAGQTVVIADIQSDRVDFATANGYADAGVVVPPKRPQAIEEKLAYA
KEVADLVKQAQVQGKAVGEVTATYECTGVETCMQTAIYATRPGGRVMIIGMGTPIQTLPI
SAAALREVDLVGVFRYANCYPKAIDLIASNPAGLPSLQKLVTHRYQGLANIADAFGMAAR
VKDDEGNLVLKVMVDLTS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattctaaagtacaagcatctgtgcttcatggtgctaaggatctcagagttgaa
gaccgcgatctgcctgctccctctgccgatgaagtccaaattgccgtcgaggccacaggg
ctctgtggctccgaccttcactactattctcactaccggaacggcgacatcatcgtttgc
gagcccttgactctcggtcacgagtccgccggcactgtcactgctgttggctcggctgtc
acgagcctagctgctggtgatcgcgtagccctcgaagtcggcctgccttgcgggtcatgc
gatctctgcgctcagggccgttacaatatctgcccaggcatgaagttccgcagctctgca
aaagccaaccctcatgcgcaaggcacgctgcaggagagggtgaaccaccccgcgaaatgg
gttcacaaactccccgatgccgtatccctcgaacttggcgccttggtcgaacctctctct
gtcgcgatgcatgcccgcaaccgcgccaacctgccttccggttccacggtgcttgtgctg
ggagctggtgctgtaggcctgctcgttgcggctgtcagcaaagccgcagggcagactgtt
gtcattgccgacatccagtccgatcgcgtagactttgccacagcgaacggctacgctgac
gctggcgttgtcgtcccgcccaagaggccacaagccattgaggagaagcttgcctatgcc
aaggaggttgcggaccttgtcaagcaggcacaagtccagggcaaggcagtcggagaggtt
actgccacatatgagtgcactggtgtagaaacctgcatgcagacggccatctacgccacg
agacccggcggcagggtcatgatcatcggcatgggtactcccatccagaccttgccaatc
tcggcagcggctctgcgcgaggtcgaccttgtcggtgtcttccgctacgcgaattgctat
cctaaggccattgacctcatcgcgagcaaccccgcgggcctgccctcgcttcagaaactt
gttacacacaggtatcagggtcttgccaacattgccgacgcctttggcatggccgctcgc
gtcaaggatgacgaaggcaatcttgtgctcaaagttatggtcgatttaacatcgtag

DBGET integrated database retrieval system