KEGG   Verticillium alfalfae: VDBG_04542Help
Entry
VDBG_04542        CDS       T02227                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
val  Verticillium alfalfae
Pathway
val00010  Glycolysis / Gluconeogenesis
val00051  Fructose and mannose metabolism
val00052  Galactose metabolism
val00500  Starch and sucrose metabolism
val00520  Amino sugar and nucleotide sugar metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01130  Biosynthesis of antibiotics
val01200  Carbon metabolism
Module
val_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
val_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VDBG_04542
   00051 Fructose and mannose metabolism
    VDBG_04542
   00052 Galactose metabolism
    VDBG_04542
   00500 Starch and sucrose metabolism
    VDBG_04542
   00520 Amino sugar and nucleotide sugar metabolism
    VDBG_04542
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    VDBG_04542
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:val04131]
    VDBG_04542
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     VDBG_04542
Membrane trafficking [BR:val04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    VDBG_04542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 TPP_enzyme_N
Motif
Other DBs
NCBI-GeneID: 9530150
NCBI-ProteinID: XP_003004936
UniProt: C9SHL0
LinkDB All DBs
AA seq 492 aa AA seqDB search
MVGIGPKPPPSRKGSMAELPQDLVQEIRHLEEILIVKASKLKEITNHFVSELEKGLSVEG
GSIPMNPTWVMSFPDGYETGTYLALDMGGTNLRVCEITLTDKKSEFDITQSKYRMPEELK
TGVSEELWEYIADCLQQFIDTHHPELPKDQKLPLGFTFSYPATQNYIDEGILQRWTKGFD
IDGVEGKNVVPLLDAALKSKGVPIKLSALINDTTGTMIASAYTDTKMKIGCIFGTGCNAA
YMEDCGSIPKLAHMNLPADAPMAINCEWGAFDNEHKVLPRTPYDIIIDQDSPRPGQQAFE
KMIAGLYLGEIFRLVLVDVHENKPVDLFKGQDISALRKAYSLDSSFLSAIEEDPFENLSE
TQDLFAAKLNLNLNRAELEFVRRLAELVGTRAARLSACGVAAICKKKNYETCHVGADGSV
FNKYPHFKERGALALREILDWPEKKNPTDEDPIEILAAEDGSGVGAALIAALTLKRVQQG
NVAGILHPDNFK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcatcggtcccaagccgcccccaagccgcaagggctcgatggcggagcttccc
caggacctggtccaggagatccgtcacctcgaagagatcctcatcgtcaaggcctcgaag
cttaaggagatcaccaaccacttcgtctctgagctcgagaagggtcttagcgtcgagggc
ggaagcattcccatgaacccgacctgggtcatgtccttccctgatggctatgagacgggt
acttatctcgctcttgacatgggcggcaccaacctgcgagtttgtgagatcaccttgacg
gataagaagtccgagttcgatattacgcagtccaagtatcgcatgcccgaagagctcaag
actggtgtttctgaggagctctgggagtacattgcagactgtctccagcagttcatcgac
actcatcaccctgagctccccaaggaccagaagctgcctcttggtttcactttttcctac
cccgccactcagaactacatcgacgagggtattctgcagcgctggaccaagggttttgac
atcgatggcgttgagggcaagaacgtggtgcccctgctcgatgctgctctgaagagcaag
ggtgttcctatcaagctttcggccttgatcaatgacactactggtactatgatcgcctcg
gcttacactgacaccaagatgaaaattggctgcatcttcggcacgggctgcaacgctgcc
tacatggaggactgcggctccatcccaaagctggcgcacatgaacctgcctgccgatgct
cctatggccatcaactgcgagtggggcgccttcgacaatgagcacaaggtcctgccgcgc
acaccttacgacatcattattgaccaggactctcctcgtcccggccagcaggccttcgag
aagatgattgctggtctctatctcggcgagatcttccgtctcgttctcgttgatgttcac
gaaaacaagcctgttgatctgttcaagggccaggacatttccgcgttgcgcaaggcctac
tcgcttgactcttcgttcctgtctgccattgaggaggaccccttcgagaacttgtcggag
acccaggatctcttcgccgccaagctcaacctgaaccttaaccgcgctgagcttgagttc
gtccgccgccttgctgagctagtcggtactcgcgctgcccgcctctcagcctgcggtgtt
gctgctatctgcaagaagaagaactacgagacttgccacgttggtgccgacggctccgtc
ttcaacaagtaccctcacttcaaggagcgcggtgccctggcgctccgcgagatcctcgac
tggcccgagaagaagaacccgactgacgaggaccctatcgagattctggccgccgaggac
ggtagtggtgtcggtgctgcgctgattgccgctctcacactgaagcgcgtccagcagggc
aacgttgccggtatcctgcacccggacaacttcaaataa

DBGET integrated database retrieval system