KEGG   Verticillium alfalfae: VDBG_04666Help
Entry
VDBG_04666        CDS       T02227                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
val  Verticillium alfalfae
Pathway
val00020  Citrate cycle (TCA cycle)
val00190  Oxidative phosphorylation
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01130  Biosynthesis of antibiotics
val01200  Carbon metabolism
Module
val_M00009  Citrate cycle (TCA cycle, Krebs cycle)
val_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
val_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VDBG_04666
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VDBG_04666
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VDBG_04666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 9530277
NCBI-ProteinID: XP_003005060
UniProt: C9SHY4
LinkDB All DBs
AA seq 671 aa AA seqDB search
MVHTMARQTWRVGNGPATELITNSVIGRQGRANPAEGDRELPLFASNARLEIIVQSILIT
NRFVGQRLHPIDDHGILHGNEETGHRALPRVFANGPLRAKEASPFDHEYDAIVVGAGGSG
LRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWL
GDQDAIHYMTREAPASIVELENYGCPFSRTEDGKIYQRAFGGQSQNFGKGGQAYRCCAAA
DRTGHALLHTLYGQSLRHNTNYFIEYFALDLIMQDGECRGVLAYNQEDGTLHRFLANHTV
LATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGARG
EGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGADKDHIFLQLSHLPA
DVLHERLPGISETAGIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEVLTVDEAGNDKVV
PGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFTPGTKLKPMEADAGAEH
IEVLDQVRNSDGPRTTAQIRLSMQKAMQTEVSVFRTQESLDEGVRLMKDIDTQFPEVGIK
DRSMIWNSDLVETLELRNLLTCASQTAVSAANRTRSPKEPHGKVDLGYRRVIATTLDENE
CKAVPPFKRVY
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacacaatggctcgacaaacgtggcgcgtcggcaatggaccggctactgagcta
atcacaaattctgtgattggtcggcagggtcgagccaacccggccgagggcgaccgagag
ctgccactgttcgcctccaatgcacgtctcgaaatcattgtccagagcattctcatcacc
aaccgcttcgtaggacagagactacatccaattgacgatcatggcatcctccatggcaat
gaggagactggccaccgcgccctccctcgggttttcgccaatggccctctgcgcgccaag
gaggcatctcccttcgaccacgagtacgatgccatcgttgttggcgccggtggttccggt
ctgcgcgccgctttcggtctcgccgaggctggcttcaacacagcctgtatctccaagctg
ttccctacccgaagccacaccgtcgccgcccagggcggcatcaacgccgccctcggcaat
atgcacgaggacgactggagatggcacatgtacgacaccgtcaagggctccgattggctc
ggtgaccaggacgccattcactacatgacgagggaagctcccgcgtccattgtcgagctt
gagaactacggctgccccttctcgcgtaccgaggatggcaagatctaccagcgtgctttc
ggtggtcagtcccagaacttcggcaagggtggccaggcctaccgttgctgcgccgccgct
gaccgaactggccacgcccttctgcacaccctgtacggccagtctctccgccacaacacg
aactacttcatcgagtacttcgccctcgacctgatcatgcaggacggtgagtgccgcggt
gtcctggcttacaaccaggaggacggcactctgcaccgcttcctcgccaaccacaccgtc
ctcgccaccggtggatacggccgcgcctacttcagctgcacttccgcccacacctgtacc
ggtgacggtatggccatggttgctcgtgccggtcttcccaaccaggatctcgagttcgtc
cagttccaccctaccggtatctacggagccggctgcctgatcaccgagggtgctcgtggt
gagggtggttacctgctcaactcggagggcgagcgcttcatggagcgttatgctcccacc
gccaaggatcttgcctcgcgcgacgtcgtgtctcgctccatgaccatggagatccgtgac
ggtcgtggtgttggcgctgacaaggaccacattttcctgcagctcagccacttgcccgcc
gacgtcctgcacgagcgtctgcctggtatttccgagacagccggtatcttcgccggtgtc
gacgtcaccaagcagcccatccccgtcctgcccaccgtccactacaacatgggcggtatc
cctaccaagtacactggtgaggtcctcaccgttgacgaggccggcaacgacaaggtcgtc
cctggcctattcgcctgcggtgaagctgcctgtgtgtcggtccacggcgccaaccgtctc
ggtgccaactcgctcctcgatctcgtcgtcttcggccgtgccgtctcccacaccatccgc
gacaacttcacacccggcaccaagctcaagcccatggaggctgatgctggtgccgagcac
atcgaggtcctcgaccaggtccgcaactcggacggtcccaggacaaccgcccagatccgt
ctctccatgcagaaggcgatgcagaccgaggtctccgtcttcaggacacaggagagcttg
gacgagggtgtccgcctcatgaaggacattgacacccagttccccgaggtcggcatcaag
gaccgcagcatgatctggaactccgaccttgttgagactctcgagctgaggaaccttctg
acttgcgcctcgcaaaccgccgtttccgccgccaaccgcacacggagtcccaaggagccc
cacggcaaggtcgacctcggctaccgccgcgtcatcgccacgacgctcgacgagaacgag
tgcaaggccgtgccgccgttcaagcgtgtgtactaa

DBGET integrated database retrieval system