KEGG   Verticillium alfalfae: VDBG_05736Help
Entry
VDBG_05736        CDS       T02227                                 

Definition
(RefSeq) glutathione transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
val  Verticillium alfalfae
Pathway
val00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VDBG_05736
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:val02000]
    VDBG_05736
Enzymes [BR:val01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VDBG_05736
Transporters [BR:val02000]
 Other Transporters
  Pores ion channels [TC:1]
   VDBG_05736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_C_5 GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 9531615
NCBI-ProteinID: XP_003004623
UniProt: C9SJL3
LinkDB All DBs
AA seq 286 aa AA seqDB search
MSNVDLSIPTHATGAAANFAAKHASNHDLAFYGGWFCPFVQRSWMVLHEKRIDHHYKEVN
PYNKDPDGPNKEFLGLNPRGLIPTMAVPARDGGGKVRPLYDSTIVSEYLDEEYADESKHG
PRLFPTDPYERARCRLWIDHINNKIVPGFYKFIQHTPEKTHSIDNARSEFLNHIRTLVRE
MHPSGPWFLGERFSMVDVMLAPWAMRLFLIDHYKPGGVGIPPPTKETGELETWSRWKTWF
DAISERQSVKDTLSAREAYVASYKRYAEDTTNSLVAQATRSGGRMP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgttgacctctccattccaactcatgctaccggcgccgccgcgaatttcgcg
gcgaagcacgcaagcaaccatgacttggccttctatggcggctggttttgtccctttgtc
cagcgctcttggatggttcttcacgagaagcggattgaccatcactacaaggaggtgaac
ccctacaacaaggatcccgatggtcccaataaagagtttctcggcctgaatccacgcggc
ctgatccccaccatggctgttccagcacgagacggaggggggaaggtccgtcccttgtac
gacagcaccatcgtctccgaatatctcgacgaggaatatgcagacgagtcgaagcatggc
cctcgacttttccctacggatccttacgaacgcgcaaggtgcaggctctggatcgaccac
atcaacaataagattgtcccaggcttttacaagttcatccagcacacccccgaaaagacc
cactcaatcgacaacgcgcgatctgagtttctgaaccatatccgaaccctagttcgtgag
atgcaccctagcggaccgtggttccttggcgagcgcttctccatggtcgatgtgatgctt
gcgccgtgggctatgcgactgtttttgatcgaccactacaagcctggcggtgtgggcatt
cctcctccgaccaaggaaactggcgagctcgagacctggtctcgatggaagacgtggttc
gatgccatcagcgagcgacagagcgtgaaagacacactgagtgctcgggaggcgtatgtt
gcgtcctacaagcggtacgcagaagacactaccaattccttggtagcgcaggccactagg
agtggaggacggatgccgtaa

DBGET integrated database retrieval system