KEGG   Verticillium alfalfae: VDBG_06382Help
Entry
VDBG_06382        CDS       T02227                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
val  Verticillium alfalfae
Pathway
val00500  Starch and sucrose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDBG_06382
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     VDBG_06382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 DUF368
Motif
Other DBs
NCBI-GeneID: 9535533
NCBI-ProteinID: XP_003003939
UniProt: C9SNA7
LinkDB All DBs
AA seq 583 aa AA seqDB search
MRFSSILSLGGLAVQSVSGLPGTLEKRVNVDQWIQQELPIARAQLLCNIGPNGCNSAGVA
SGLVIASPSKSDPDYFFHWTRDAGLVFKAIIDLFVENYDAGLQQNIQNFIVGQAKLQTVN
NPSGSFSSGAGLGEAKYLANGAQFTGDWGRPQRDGPALRAIALIKYSKWLIANGYTSTAN
TVVWPIIRNDLAYVTQYWNQTGFDLWEEVQGSSFFTIASQHRSLVEGAALAQQLGQTCNG
CAGIAPQILCFQQRFWNPSQGYVISNINGGSYRNGKDANSILTSIHNFDPVLGCDASTFQ
PCSDRALSNHKVVTDSFRSIYGINNGKGQGQAALIPGISTGTYASTSSTYTSILSAVKAY
ADGYVDVAATYIPGGGNIAEQYNRNTGQPLSARDLTWSYASFLTVAQRRREVVGLGWANS
AASVVPNTCFATSVQGSYTSATATSFPANQTPATGAPTGTATTATAPAATTTAACVPPVN
VDITFNARVVTQFGQTVKIVGNIPQLGNWNTANAISLSASQYTSSNPVWSGTLSLPAGQA
IQYKYINVASNGAVTWEKDPNRSYSIPSACGTTSAIRTDSWQA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctcatccattctgtcgcttggcggcctggccgtccagtccgtctccggtctc
cccggaactctcgagaagagggtcaacgttgatcagtggatccagcaggagctgcccatt
gcccgggcccagcttctgtgcaacattggccccaacggctgcaactctgccggtgtcgcc
tcgggtctcgttatcgcctcgcccagcaagtcggaccctgactacttcttccactggact
cgcgatgctggtcttgttttcaaggccatcattgacctgttcgtcgagaactacgatgcg
ggtctccagcaaaacatccagaacttcattgtcggccaggccaagctgcagactgtcaac
aacccttccggcagcttctcgagcggcgccggtcttggcgaggccaagtatctcgccaac
ggagcccagttcaccggtgactggggccgcccccagcgcgacggcccggctcttcgcgct
atcgccctgattaagtactccaagtggctcattgccaatggctacacctcgaccgccaac
accgtcgtctggcccatcatcaggaacgacctggcttacgtcactcagtactggaaccag
accggtttcgacctgtgggaggaggttcagggctcgtccttcttcaccatcgcctcccag
caccgctccctcgtcgagggtgctgctctcgcccagcagctcggccagacctgcaacggc
tgtgccggcatcgctccccagatcctctgcttccagcagcgtttctggaacccttctcag
ggctacgtcatctccaacatcaacggtggcagctaccgcaacggcaaggatgccaactct
atcctcacctccattcacaacttcgaccctgtcctcggctgcgacgcttccaccttccag
ccctgcagtgaccgtgctctctcgaaccacaaggttgtgaccgactctttccgatccatc
tacggcatcaacaacggcaagggccagggccaagccgctctgatccccggcatctccacc
ggcacctacgcttccacctcctcgacctacacttcgatcctctccgccgtcaaggcctac
gctgacggttacgtcgatgtcgccgccacctacatccccggcggtggcaacattgccgag
cagtacaaccgcaacacgggccagcccctctctgctcgcgatctcacctggtcttacgcc
tcgttcctgaccgtcgctcagcgtcgccgcgaggttgttggtctcggctgggccaactct
gccgccagcgtcgtccccaacacctgcttcgcgacgtccgtccagggctcgtacaccagc
gccaccgcgaccagcttcccggccaaccagactcccgccaccggagccccgacgggcact
gccacgactgcgaccgccccggctgccaccaccacggccgcctgcgtcccccccgtcaac
gttgacatcaccttcaacgcccgcgtcgtcacccagttcggccagactgtcaagattgtt
ggcaacattcctcagctcggcaactggaacacggccaacgccatctccctgagcgcctcc
cagtacacctcctccaaccccgtgtggagcggcaccctgagcctgcccgccggccaggcc
atccagtacaagtacatcaacgtcgcctccaacggcgccgttacttgggagaaggacccc
aaccgctcttacagcattccctcggcctgcggcaccaccagcgccatcaggaccgactcc
tggcaggcttaa

DBGET integrated database retrieval system