KEGG   Verticillium alfalfae: VDBG_06755Help
Entry
VDBG_06755        CDS       T02227                                 

Definition
(RefSeq) protein kinase byr2
  KO
K11228  mitogen-activated protein kinase kinase kinase [EC:2.7.11.25]
Organism
val  Verticillium alfalfae
Pathway
val04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:val00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    VDBG_06755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:val01001]
    VDBG_06755
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     VDBG_06755
Protein kinases [BR:val01001]
 Serine/threonine kinases: STE group
  STE11 family
   VDBG_06755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Ras_bdg_2 SAM_2 SAM_1 RA Kinase-like Pkinase_fungal SAM_4
Motif
Other DBs
NCBI-GeneID: 9537319
NCBI-ProteinID: XP_003003193
UniProt: C9SPD0
LinkDB All DBs
AA seq 845 aa AA seqDB search
MAMLAPKSSFPAGLGSNSSNMVASNMSPASVGPSRRAPTLPNSTASFASPTESEFSESEG
PDAVKNWDEERVAEYLRSVKCGEYEKLFRKNHINGENLLELDKNVLKEMGIDKVGDRVRL
FLGIKKLRTKAYANQKKRNRDSFGLLDSQYMASANSPRPSGPSTSSSAGRGMPTPPMNKR
YSRQIDMPLPLDTSKSSSRPSSPLPGSDARQARQRYGQSPGYMSNAGPNASSRSPHELPQ
ANRLVTSHHTRNQSSMDGSLMAGLPQNQEVIRVISTGGVTKVVKIADCNTCEEVMRVTLR
KFALREDHERNYCFWVLAGVDPDPSQCRRLGDTELWRIIKDQKRPERNRLILRRVPAGEP
GMSELERAAGIAVEEAQQNHVRALESVDKRSQLKVQNLLGERWNDELQHPLSPVSFQDRE
PVLSVASNLSFASSIADAPPIPTIADTWLTASAQAAKPLNQAARQAARNTHAYRDSVTSS
VLDTLQEESPIEPNRKSYVSFADSNSDTAAVSVTDPDGNITRKSFFDGESTISTGSGSVE
QLTQALNEDGEDEDEELQSFLAGESWSDDKWMKGALIGQGSFGSVYLALHAVTGELLAVK
QVEAPAPGANSQSDGRKKSMIEALKREISLLRDLRHPNIVQYLGCSSSSEFLNIFLEYVP
GGSVQTMLNSYGALPEPLVRSFVRQILTGLSYLHNRDIIHRDIKGANILVDNKGTIKISD
FGISKKLEASNILSGANNNKHRPSLQGSVFWMAPEVVKQTSYTRKADIWSLGCLVVEMMT
GSHPFPDCTQMQAIFKIGGAMAAPTIPEHASPEAQKFLAQTFEIDYNLRPSADELMLSPF
LAPIT
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggccatgctggctccaaaatcgtcgttccccgcgggcttgggctccaacagctccaac
atggtcgccagtaacatgtctcccgcctccgtcggcccctccaggagagcgcccactctg
cccaattcgactgcctctttcgccagcccgaccgagtccgagttctcggaaagcgaaggt
cccgacgccgtcaagaattgggacgaggagcgtgtcgccgagtacctcaggagtgtcaag
tgtggcgagtacgagaagcttttcaggaaaaaccacatcaacggcgagaatctacttgag
ctcgacaagaatgtcctcaaggaaatgggtatcgacaaggtcggcgaccgcgtacgcctg
ttccttggcattaagaagctgagaaccaaggcctacgcaaaccaaaagaagaggaatagg
gactccttcggtctcctcgactcccagtacatggcctctgccaactcgcctcggccctct
ggcccttcgacgtcgtcctccgccggccgtggcatgcccactcctccgatgaataagcgc
tactcgcgccagatcgacatgcccctacctctcgatacctcgaagtcctcctcgcgcccc
agttctcctctgccaggctccgatgcgcgccaggctcgtcagcgctacggccagagcccc
ggctacatgagcaacgctggccccaatgcttcttcaagatcgccgcacgagctgccccag
gctaatcgattggtaacatctcaccataccaggaatcagtccagtatggatggctcactg
atggctggtttaccgcagaatcaggaagttattcgtgtcatctccaccggaggcgtgacc
aaggttgtcaagattgccgactgcaacacgtgcgaagaagtcatgcgcgtcacactacgc
aagtttgctctgcgcgaggaccacgagaggaattattgcttttgggtccttgctggcgtt
gatcccgaccctagccagtgccgtcgcctcggcgacaccgaactgtggcgcatcatcaag
gaccagaagcgtcccgaacgaaaccgcctcatcctacgccgtgtgcccgctggcgagcct
ggcatgtcagagctggagcgggctgccggcatcgccgtcgaggaggcacagcagaaccat
gtccgtgccctcgagtcggtcgataagaggagtcagctcaaggtgcagaaccttctgggc
gaacgctggaacgacgaactccagcatcctctctcgcccgtttccttccaggaccgcgag
cccgttttgagtgttgcgagcaacctgagctttgcctcgagtattgccgacgctccgccc
attcccacaatcgccgacacatggttgaccgcctcggctcaggcggcgaaacccctgaac
caggcagcccgccaagcagcccgcaacacccatgcataccgcgactcggtcacgtcgtcg
gtgcttgacaccctccaggaggagtcacccatcgagcccaaccgcaagtcttacgtttcc
ttcgccgacagcaattcggatactgcggcggtgagcgtcactgatcccgacggcaacatc
acaaggaagagcttcttcgatggcgagtccacaatctccacgggctccgggtctgtggag
cagctcactcaggccctaaacgaggatggcgaggacgaagacgaggagctccagagcttc
cttgccggcgagtcctggtctgatgacaagtggatgaagggtgctctcatcggccagggt
tcctttggctccgtctatcttgctctgcacgccgtcaccggcgagctacttgctgtgaag
caggtcgaggcgcccgctcccggtgccaacagccagagcgatggccgcaagaagagcatg
atcgaagctctcaagcgcgagatcagtctgctccgtgacctccgacaccccaacattgtg
caatacctaggctgcagctcgtcgtccgagttcctcaacattttccttgagtacgtcccg
ggtggctccgtgcagaccatgcttaactcgtatggtgctctgcccgagccacttgtgcgt
agctttgtccgacagattctcactggtctctcgtacctgcataaccgcgacattattcac
cgagacatcaagggtgccaacatcctcgtcgacaacaagggaaccatcaagatttctgat
ttcggtatctccaagaagctcgaggcatccaacattctcagcggcgcgaacaacaacaag
catcgtccctcgcttcagggttctgtcttctggatggcgcccgaggttgtcaagcagacg
tcttatactcgcaaggcggatatttggtctctcggctgccttgtcgtcgagatgatgacg
ggctcccatcccttccccgactgtacccagatgcaggctatcttcaagattggcggcgcc
atggctgcgcctaccatcccggagcacgccagccccgaggcacagaagttcctcgcccag
acctttgagattgattacaaccttcgcccaagcgccgacgagctcatgctcagccccttc
ctggcgcccatcacttga

DBGET integrated database retrieval system