KEGG   Verticillium alfalfae: VDBG_07267Help
Entry
VDBG_07267        CDS       T02227                                 

Definition
(RefSeq) alpha-amylase A type-3
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
val  Verticillium alfalfae
Pathway
val00500  Starch and sucrose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDBG_07267
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VDBG_07267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 hDGE_amylase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 9527701
NCBI-ProteinID: XP_003002696
UniProt: C9SQN2
LinkDB All DBs
AA seq 462 aa AA seqDB search
MRISALFVSALQLVASVQAASTAEWKTRSIYFVLTDRIARSSTDTGGNACGNLGNYCGGT
FRGLQSKLDYIQGMGFDAIWITPVVANTPGGYHGYWAQDLYSINSNLGTADDLKSLVNAA
HAKNMFVMVDVVANHMGQGSISNLRPEPLNQASSYHSDCQINYNNQNSVENCRIAGLPDI
NTSNPALRTLLQNWIGWLVEEFGFDGIRIDTVKHVEKDFWPPFTWASGVYSLGEVFDGNP
DYLAGYNNLMSGLLNYGVYYPMNRFYQQKSASPQELVDMQNRLSNIVSDPTAWATFLDNH
DNPRWLNQKNDQTLLQNALAYVILARGVPIVYYGTEQGYGGGNDPANREDLWRSGFNTNS
NLYQAIAKLNRAKKNAGGLAGNDQVNLQVWTNAYAWSRAGGDLVVLTTNYGSSRNSEYCF
NTQRPNTTWNDVFGTGTYTSNGSGQVCVQIRNGLPVVLAIRR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttccgccttgttcgtctcggcgctgcagctcgtggcgagcgtccaggctgcc
agcaccgcagagtggaagacgcgcagcatctacttcgtcttgacggaccgtattgctcgc
agcagcactgacacgggcggcaatgcatgtggtaacctcggaaactactgtggcggcacg
ttccgtggattgcagtcgaaactcgactacatccagggcatgggtttcgatgccatatgg
atcactcccgtcgttgccaacacccctggaggctatcacggctactgggcccaggacctg
tactcgatcaactccaacctcggcactgccgatgatttgaagagtcttgtcaatgctgca
cacgcaaagaacatgttcgttatggtcgacgtggtcgccaaccacatgggccagggatct
atcagcaacttgcgcccggagccgctgaaccaggccagctcataccattcagactgccag
atcaactataacaaccaaaacagcgtcgagaactgccgcatcgctggtctcccggacatc
aacaccagcaaccccgctctccgcaccctgctccagaactggatcggctggctcgttgag
gagtttggctttgacggtatccgcatcgatacggtcaagcatgttgagaaggacttctgg
ccgcccttcacctgggcttcaggcgtctactcgctcggcgaagtcttcgacggcaaccca
gactacctcgccggctacaacaatctcatgagcggcctgctgaactacggcgtctactat
ccgatgaaccgattctaccagcagaagagtgcatcgcctcaggagctcgttgacatgcag
aaccgactcagcaacatcgtcagcgaccccacagcctgggctaccttcctcgacaaccac
gacaacccgcgctggctcaaccagaagaacgaccagacactactgcaaaatgccctcgcc
tatgtcatcctggcgcgtggcgtgcccatcgtgtactatggtactgagcagggctacggt
ggcggcaatgaccctgcgaaccgcgaggacctttggaggagtggcttcaacacgaactct
aatctctaccaggccattgccaagctcaaccgtgcgaagaagaacgctggtggtctggcc
ggtaacgaccaggtcaacctgcaggtctggaccaacgcatacgcgtggagccgcgccgga
ggcgatctcgttgtgctgacaacgaactatggatcaagccgcaacagcgaatactgcttc
aacacgcagaggccgaacacgacatggaatgatgtttttggaactggtacctacacctcg
aatggatcaggccaagtctgcgtccagattaggaacggtctgcccgtggtgttggctatc
aggcgctga

DBGET integrated database retrieval system