KEGG   Verticillium alfalfae: VDBG_08058Help
Entry
VDBG_08058        CDS       T02227                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
val  Verticillium alfalfae
Pathway
val00052  Galactose metabolism
val00500  Starch and sucrose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VDBG_08058
   00500 Starch and sucrose metabolism
    VDBG_08058
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     VDBG_08058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 9529939
NCBI-ProteinID: XP_003001799
UniProt: C9ST33
LinkDB All DBs
AA seq 823 aa AA seqDB search
MHYWKTLLVPGVAAAAVLKRDSPDYDKLADCPGYAASNVKTTGNGLTAELKLAGPACNTY
GTDLEELTLSVTYESESRIHVKIQDPADQVYQVPESVFPRPDEGSFSGDAKIKFDYTEEP
FAFTIKRADTEEVLFDTSAASIVFESQYLRLRTSLPEDPYLYGLGEHTDPFRLNTTNYIR
TLWNRDSYGVPYGSNLYGSHPFYIEQRETGTHGVFLLNSNGMDVMVNKDDAGQYLEYNTL
GGVLDFWFLSGPSPVDVVKQYSDIVGFTLDPRRYPVEKVRQIVDYLHEHDQHYIVMVDPA
VAYEESDIVNRGRQDDIWLQHPNGSEYLGVVWPGVTIFPDWFAENITKYWNNEFDIFFDK
DTGVDIDGLWIDMNEPANFCNGLCDDPFGDAVGYPPEPPAVRENPRALPGFGCEFQLPGA
CDGNAERRQIEAHPARPRAAGAETSSLDVRQTGSGDRKGLPDRDLLYPKYAIHNDAAGPD
VSWNADRGGLSFKTVKTDIAHQNGLVMYDTHNLYGAMMGKASRDAMMARREGLRPFIITR
STFPGDGKAVGHWLGDNLSQWDHYRFAIYTTMTFSALYQFPMAGSDEFYRWPAVAESARK
AIDIRYRLLDYIYTAIYKATVDGSPTLNPMYFIYPEDRATWALQHQFFYGDAVLVAPVTE
QDATSVDVYLPKDTFYDWYTHRPIRGKGALHTFEDQDVTDIPLLIRSGKILPLRVASANT
TTALRQNDFELLVTLDVDGKASGELYLDDGVSLVQQGHTLIDFTFENGVLSLDGTFGYEV
DVKIVKVKVLGASCRTGAGKEGRGSKTVKVDLSLNKAGSVKVW
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgcattactggaagaccctgctcgttcccggtgtggccgcggcggccgtgctcaagagg
gactccccagactacgataagcttgccgattgtcccggctatgctgcctcgaacgtcaag
acgaccggcaacggtctgactgccgagctgaagcttgctggcccggcctgcaacacgtac
ggcaccgacctcgaggagcttactctgtcggtcacctacgagagcgagtcccgtatccac
gtgaagatccaggatccggcggaccaggtttaccaggtccccgagtctgtcttcccccgg
cccgacgaaggctctttctccggtgacgccaagatcaagtttgactacaccgaggaaccc
tttgccttcaccatcaagagggccgatacggaggaggttctcttcgacacctcggccgcc
tccatcgtcttcgagtcgcagtacctccgcctgaggacgagcctgcccgaggacccttac
ctctacggcctcggcgagcacaccgaccccttccgcctcaacacgaccaactacatccgc
acgctgtggaaccgtgacagctatggtgttccgtacggcagcaacctgtacggcagccac
cccttctacatcgagcagcgcgagacgggcacccacggcgtcttcctcctcaactcgaac
ggcatggacgtcatggtcaacaaggacgacgccggccagtacctcgagtacaacacgctc
ggtggcgtgctcgacttctggttcctctccggcccctcgcccgtcgacgtcgtcaagcag
tactcggacattgtcggcttcaccctcgacccccgccgctaccccgtcgagaaggtccgc
cagatcgtcgactacctccacgagcacgaccagcactacattgtcatggttgacccggcc
gtcgcctacgaggagtcggacattgtcaaccgcggtcgccaggacgacatttggctgcag
caccccaacggctccgagtacctcggcgtcgtctggcccggcgtcaccatcttccccgat
tggtttgccgagaacatcaccaagtactggaacaacgagtttgacatcttcttcgacaag
gacacgggtgtcgacattgacggtctgtggatcgacatgaacgagcccgccaacttctgc
aacggtctctgcgatgacccctttggcgacgccgtcggctacccgcccgagccccccgcc
gtccgcgagaacccccgcgccctgcccggctttggctgtgagttccagctccccggtgcc
tgcgacggcaacgccgagcgccgccagatcgaggctcaccccgcccgcccccgtgccgcc
ggcgccgagacgtcttcgctcgacgtccgccagaccggctcgggcgaccgcaagggtctc
cccgaccgcgacctcctgtaccccaagtacgcgatccacaacgacgcggcggggcccgac
gtgtcgtggaacgcggaccgcggcggcctctcgttcaagacggtcaagacggacattgcg
caccagaacggtctcgtcatgtacgacacgcacaacctctatggcgccatgatgggcaag
gcgtcgcgcgacgccatgatggcgcgccgcgagggcctgcggcccttcatcatcacgcgc
agcacgttccccggcgacggcaaggccgtgggccactggctcggtgacaacctttcgcag
tgggaccactaccggttcgccatctacacgaccatgaccttctcggcgctgtaccagttc
cccatggccggctcggacgagttctaccgctggcccgccgtcgccgagtcggcccgcaag
gccatcgacatccgctaccgcctgctcgactacatctacacggccatctacaaggccacc
gtcgacggcagcccgacgctgaaccccatgtacttcatctaccccgaagaccgcgccacc
tgggccctgcagcaccagttcttctacggcgacgccgtcctcgtcgcccccgtcaccgag
caggatgccacgagcgtcgacgtctacctgcccaaggacaccttctacgactggtacacc
caccgtcccatccgtggcaagggcgccctgcacacctttgaggaccaggacgtcaccgac
attccgctgctcatccgctccggcaagatcctgccgctgcgcgtcgcctcggccaacacg
acgacggcgctgcgccagaacgactttgagctgctcgtcaccctcgacgtcgacggcaag
gccagcggcgagctgtacctcgacgacggcgtgtcgctcgtccagcagggccacaccctc
atcgacttcacctttgagaacggcgtgctctccctcgacggcaccttcggctacgaggtc
gacgtcaagattgtcaaggtcaaggtcctcggcgcctcgtgccgcaccggtgctggtaag
gagggccgtggcagcaagactgtcaaggttgacctgtcgctgaacaaggcgggctccgtc
aaggtctggtga

DBGET integrated database retrieval system