KEGG   Variovorax sp. PMC12: C4F17_01925Help
Entry
C4F17_01925       CDS       T05380                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00010  Glycolysis / Gluconeogenesis
vam00620  Pyruvate metabolism
vam01100  Metabolic pathways
vam01110  Biosynthesis of secondary metabolites
vam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C4F17_01925
   00620 Pyruvate metabolism
    C4F17_01925
Enzymes [BR:vam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     C4F17_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AVQ79808
UniProt: A0A2P1V3T2
LinkDB All DBs
Position
1:423203..424723
Genome map
AA seq 506 aa AA seqDB search
MDMLEPGKFGTAVPFKKRYGNYIGGEWVSPLENQYFDNITPVTGKVFCEVPRSTAADIDR
ALDAAHKAKAAWGRTSTTERANILNRIADRMQENLPVLAAAETWDNGKPIRETMAADLPL
AVDHFRYFASCIRAQEGGISEIDHETFAYHFHEPIGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPVSILVLMEIIGDLLPPGVLNVVNGFGVEAGKPLASSNRIGKIAFTG
ETTTGRLISQYASQNLIPITLELGGKSPNIFFADVMDRDDSFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVAAIKQGSPLDMGTMIGAQASSEQLEKILSYLDIGR
QEGAEVLIGGERARLEGDLADGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDEEEAL
SIANDTLYGLGAGVWSRDMNRAFRMGKGIQAGRVWTNCYHHYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSENKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggacatgctcgaaccaggcaaattcggtaccgcggttccgttcaagaagcgctacggc
aactacatcggcggcgaatgggtgtcgccgctggagaaccagtacttcgacaacatcacg
cccgtcaccggcaaggtcttctgcgaagtgccgcgttccacggcggcggacatcgaccgc
gcgctcgacgccgcgcacaaggccaaggccgcctggggccgcacctcgaccaccgagcgc
gccaacatcctgaacaggatcgccgaccgcatgcaggaaaacctgcccgtgctcgcggcc
gccgagacctgggacaacggcaagccgattcgcgagaccatggcggccgacctgccgctg
gcggtcgaccacttccgctacttcgcgtcgtgcatccgcgcgcaggagggcggcatcagc
gagatcgaccatgaaaccttcgcgtaccacttccacgagcccatcggcgtggtcggccag
atcattccgtggaacttcccgatcctgatggcggtgtggaagctggcacccgcgctggcg
gccggcaactgcgtggtgctgaagccggccgagcagacgccggtctcgatcctggtgctg
atggagatcatcggcgacctgctgccgccgggcgtgctgaacgtggtgaacggcttcggc
gtggaggcgggcaagccgctggcgtcgagcaaccgcatcggcaagatcgccttcaccggc
gagacgaccaccggccggctgatctcgcaatacgcgagccagaacctgattcccatcacg
ctggagctgggcggcaagtcgcccaacatcttcttcgccgacgtgatggaccgcgacgac
agcttcttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgtgcattgatccaggagtcgatctacgaccgcttcatggagcgt
gcgctcaagcgcgtggcggccatcaagcagggcagcccgctcgacatgggcacgatgatc
ggcgcgcaggcctcgagcgagcagctcgagaagatcctgtcgtacctggacatcggcagg
caggaaggtgccgaggtgctgatcggcggcgagcgcgccaggctcgaaggcgacctggcc
gacggctactacgtgaagccgaccgtgttcaagggccacaacaagatgcgcatcttccag
gaagaaatattcggccccgtggtgtcggtgacgaccttcaaggacgaggaagaagcgctc
tccattgccaacgacacgctctacggcctgggcgccggcgtgtggagccgcgacatgaac
cgcgccttccgcatgggcaagggcatccaggcgggccgcgtgtggaccaactgctaccac
cactatccggcgcatgcggccttcggcggctacaagcagtcgggcatcgggcgcgagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtgagctacagcgag
aacaagctgggcttcttctga

DBGET integrated database retrieval system