KEGG   Variovorax sp. PMC12: C4F17_02150Help
Entry
C4F17_02150       CDS       T05380                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00500  Starch and sucrose metabolism
vam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C4F17_02150 (treS)
Enzymes [BR:vam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     C4F17_02150 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     C4F17_02150 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AVQ79842
UniProt: A0A2P1V3S8
LinkDB All DBs
Position
1:475207..478551
Genome map
AA seq 1114 aa AA seqDB search
MNAPVSHIALETVEIDNSDDPLWYRDAVIYQLNVKAFFDSNNDGMGDFQGVTAKLDYVKD
LGVNTIWLMPFYPSPLRDDGYDISEYEDVHPQYGSLADFRQMLAEAHKRGLRVITELVIN
HTSSEHPWFKAARLAPPGSPERDFYVWSDTDQLYQGTRIIFTDTETSNWTWDPVAKQYYW
HRFFSHQPDLNFDNPAVLEAIFKTMRFWLDMGVDGFRLDAIPYLVERDGTSNENLPETHA
VIKRLRAAIDAQYKNRFLLAEANMWPEDVREYFGDGDECHMAYHFPLMPRMYMAIAQEDR
HPIVEIMAQTPDIPEGCQWAIFLRNHDELTLEMVTSKERDYMYNMYAADMRARINLGIRR
RLAPLMENDLDRVKLMNGMLLSMPGSPIIYYGDEIGMGDNVFVGDRNGVRTPMQWSPDRN
AGFSRADPQRLYLQPIMDPMYGYEALNVETQARDASSLLNWTKRMLAVRKTSHAFGRGKR
RFLKPGNRKILAYLSEYEGDVILAVFNLSRAAQPVELDLSEFRGFVPIEMLGRSPFPPIG
ELPYLLTLSSYGFYWFKLTAEADAPSWHEQGVALQEWPTLVLFDGWTSFFRDRVMPWRIG
MSERMRNQFELETLPRHIEIQRWYASKGTAIERARIVDHAVWEVNGLSWMLPLLALDGPP
GGATYFMPLALAWEERDEERMAGVAQAALAKVRQQAQVGLMGDAFYDEAFCRELVRAIGK
GAELPTAGGKLVFTPTAAFAQLGIDVDALPVGRPSGVSSNTVVTLNETLFLKGYRNVREG
INPELEMGRFLTEVAHYPHCVPVLGALEYMGADGRTMTLALVQSYVANQGDGWDYTLGYL
ERFLRDVATTDGAVDAPDVLAVHGGFLALIGTLGRRTAELHRALATRTGAAAFDPEPLSA
EDVAGYRTHAAGDATATLALLRERLGALPPGAQADAESLLRAADTLQASIAERRFVGEGG
SGAALKSRYHGDYHLGQVLVKDNDFVIIDFEGEPARSFEERRAKSSPLRDVAGMLRSFNY
ARWSALRRVAQSPEEAEKLAAPAVAWEQATRNAFMEGYAGTLAQPDGAPIDAELLALFEL
EKALYELRYELNNRADWVQVPLHGVLALIQPNGA
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacccgtttcgcacatcgcactggaaaccgtagagatcgacaacagcgacgac
cccctgtggtaccgcgacgcggtcatctaccagctcaacgtcaaggccttcttcgattcg
aacaacgacggcatgggcgacttccagggcgtgaccgccaagctcgactacgtgaaggac
ctgggcgtcaacacgatctggctgatgccgttctatccctcgccgctgcgcgacgacggc
tacgacatctccgaatacgaagacgtccacccgcagtacggctcgctcgccgacttccgc
cagatgctggccgaggcgcacaagcgcggcctgcgcgtcatcaccgagctggtcatcaac
cacacctcgagcgagcacccgtggttcaaggccgcgcggctggcgccgccgggctcgccc
gagcgcgacttctacgtgtggagcgacaccgaccagctctaccagggcacgcgcatcatc
ttcaccgacaccgagacctccaactggacctgggacccggtggccaagcagtactactgg
caccgcttcttcagccaccagcccgacctgaacttcgacaacccggcggtgctggaggcc
atcttcaagaccatgcgcttctggctggacatgggcgtggacggcttccgcctcgacgcc
attccctacctggtggagcgcgacggtaccagcaacgagaacctgcccgagacgcacgcg
gtgatcaagcggctgcgcgcggccatcgacgcgcagtacaagaaccgcttcctgctggcc
gaggccaacatgtggccggaggacgtgcgcgagtacttcggcgacggcgacgaatgccac
atggcgtaccacttcccgctgatgccgcgcatgtacatggccatcgcgcaggaagaccgc
caccccatcgtggaaatcatggcgcagacgcccgacatccccgaaggctgccagtgggcc
atcttcctgcgcaaccacgacgagctcacgctcgagatggtgaccagcaaggagcgtgac
tacatgtacaacatgtacgccgccgacatgcgcgcgcgcatcaacctgggcatccgccgg
cgcctggcgccgctgatggagaacgacctggaccgcgtgaagctcatgaacggcatgctg
ctgtcgatgccgggctcgcccatcatctactacggcgacgagatcggcatgggcgacaac
gtgttcgtgggcgaccgcaacggcgtgcgcacgcccatgcagtggagccccgaccgcaat
gccgggttctcgcgcgccgacccgcagcgcctgtacctgcagcccatcatggacccgatg
tacggctacgaggcgctcaacgtcgagacgcaggcgcgcgacgccagctcgctgctcaac
tggaccaagcgcatgctggccgtgcgcaagaccagccacgccttcggacgcggcaagcgg
cgcttcctgaagccgggcaaccgcaagatcctggcctacctgagcgagtacgaaggcgac
gtgatcctcgccgtgttcaacctctcgcgcgcggcccagccggtggagctggacctgtcg
gagttccgcggcttcgttcccatcgagatgctgggccgctccccgttcccgcccatcgga
gagctgccttacctgctcacgctgtcttcgtacggcttctattggttcaagctcaccgcg
gaggccgacgcgccgagctggcacgaacagggcgtcgcgctgcaggagtggcccacgctg
gtgctgttcgacggctggaccagtttcttccgcgaccgcgtgatgccgtggcgcatcggc
atgtccgagcgcatgcgcaaccagttcgagctggaaacgctgccgcgccacatcgagatc
cagcgctggtacgcctcgaagggcaccgccatcgagcgtgcgcgcatcgtcgaccacgcg
gtgtgggaagtgaacggcctgagctggatgctgccgctgctcgcgctcgacggcccgccc
ggcggcgccacctatttcatgcccctcgccctggcctgggaggagcgcgacgaagagcgc
atggccggcgtggcgcaggccgcgcttgccaaggtgcgccagcaggcgcaggtcggcctg
atgggcgacgccttctatgacgaggccttctgccgcgaactggtccgcgccatcggaaag
ggcgccgaactgcccacggccggcggcaagctggtgttcacgccgacggcggcgttcgcc
cagctcggcatcgatgtggacgcgctgccggtcgggcggcccagcggcgtgagcagcaac
acggtggtcacgctcaacgagacgctgttcctcaagggctaccgcaacgtgcgcgaaggc
atcaaccccgagctcgagatgggccgcttcctcaccgaagtggcgcactacccgcactgc
gtgccggtgctcggcgcactcgaatacatgggcgccgacggccgcaccatgacgctcgcc
ctggtgcagagctacgtcgccaaccagggcgacggctgggactacaccctgggctatctc
gaacgcttcctgcgcgacgtggccaccaccgacggtgccgtcgacgcgcccgacgtgctg
gcggtgcacggcggcttcctcgcgctgatcggcacgctgggccgccgcaccgccgagctg
caccgcgcgctggccacccgcaccggcgcggcggccttcgaccccgaaccgctgtcggcc
gaagacgtggcgggctaccgcacccatgccgccggcgatgccacggccacgctggcgctg
ctgcgcgaacgcctcggcgcgctgcctcccggcgcgcaggccgacgccgagagcctgctg
cgcgccgccgacacgctgcaggccagcatcgccgagcgccgtttcgtgggcgagggcggc
agcggcgccgcgctcaagagccgctaccacggcgactaccacctgggccaggtgctggtg
aaggacaacgacttcgtcatcatcgacttcgagggcgagcccgcgcgcagcttcgaggag
cgccgcgccaagagctcgccgctgcgcgacgtggcgggcatgctgcgctccttcaactat
gcgcgctggtcggccttgcggcgcgtggcgcagagcccggaagaagccgagaagctggcc
gcgcccgcggtcgcctgggaacaggccacgcgcaacgccttcatggagggctacgccggc
acgctcgcgcagccggacggcgcgcccatcgacgccgaactgctcgcgctgttcgagctg
gagaaggcgctctacgaacttcgctacgaactcaacaaccgcgccgactgggtacaggtg
ccgctgcacggcgtgctcgcgctcatccagccgaacggggcctga

DBGET integrated database retrieval system