KEGG   Variovorax sp. PMC12: C4F17_08360Help
Entry
C4F17_08360       CDS       T05380                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C4F17_08360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vam02000]
    C4F17_08360
Enzymes [BR:vam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C4F17_08360
Transporters [BR:vam02000]
 Other Transporters
  Pores ion channels [TC:1]
   C4F17_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3 GST_C_5 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AVQ80958
UniProt: A0A2P1V745
LinkDB All DBs
Position
1:1789366..1789947
Genome map
AA seq 193 aa AA seqDB search
MTMKLYFDPQSRSQVAKWMLDETGAPYEIVTTLIREKAHKKPEYLKINPAGKLPALVDGR
ARVFENAAICMYLAEKFPGKRLAPPVGSVDRGRYLSLMVYSTSQLEPAMGDSLLKIRSNN
SARGWTDFEAAKDAVERELGDGPYLFGSQFTAADVMIGSMFIWHRAFGGRSNRPKIDAYI
NRLQARPKGMKFG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaagctctacttcgacccgcaaagccgctcgcaggtcgccaaatggatgctc
gacgagaccggcgcgccctatgagatcgtgaccacgctcatccgcgagaaggcgcacaag
aagcccgagtacctgaagatcaacccggcgggcaagctgcccgcgctggtggacggccgc
gcgcgcgtgttcgagaacgcggccatctgcatgtacctggccgagaagtttcccggcaag
cggctggcaccgcctgtcggctcggtcgaccgggggcgctacctgtcgctgatggtctat
tcgacctcgcagctcgagcccgcgatgggcgacagcctcttgaagatccgcagcaacaac
agcgcccgcggctggaccgacttcgaggccgccaaggatgcggtcgagcgcgaactcggc
gacgggccctacctgttcggctcgcagttcacggcggccgacgtgatgatcggctccatg
ttcatctggcaccgcgcattcggcggccgctcgaaccgcccgaagatcgacgcctacatc
aaccggctgcaggcccgccccaagggcatgaaattcggctga

DBGET integrated database retrieval system