KEGG   Variovorax sp. PMC12: C4F17_09995Help
Entry
C4F17_09995       CDS       T05380                                 

Definition
(GenBank) superoxide dismutase family protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vam  Variovorax sp. PMC12
Brite
Enzymes [BR:vam01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C4F17_09995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AVQ81251
UniProt: A0A2P1V7W8
LinkDB All DBs
Position
1:2133278..2133814
Genome map
AA seq 178 aa AA seqDB search
MNHRRLSAIAAALAASAVLAACGSMGGKPSTVVELVPTGAITPNPTRGTVTFTALDHGVR
VSGEVRGLVPGSEHGFHIHEKGDCGNNGDASGGHFNPTGATHGKFAAPGSHAGELPSLVA
DAGGVARFSVEDHSISLTDGTPNNVIGRALVVHRDRDDFTTQPSGNSGPRIACAVITR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcgtcgtctctccgccattgccgccgccctggccgccagcgccgtactcgcc
gcctgcggcagcatgggcggcaagcccagcacggtcgtggagctggtgccgaccggcgcg
atcacgcccaacccgacccgcggcacggtgaccttcaccgcgctggaccacggcgtgcgc
gtgtcgggcgaggtgcgcggcctggtgccgggcagcgagcacggcttccacatccacgaa
aagggcgactgcggcaacaacggcgatgcctccggcggccacttcaaccccacaggcgcc
acgcacggcaagttcgccgcgccgggcagccatgccggcgaactgccgagcctggtggcc
gacgccggcggcgtggcgcgcttcagcgtggaagaccactcgatctcgctgaccgacggc
acccccaacaacgtgatcggccgcgcgctcgtcgttcaccgcgaccgcgacgacttcacg
acccagccttcgggcaattccggtccgcgcatcgcctgcgcggtgatcacgcgctga

DBGET integrated database retrieval system