KEGG   Variovorax sp. PMC12: C4F17_11280Help
Entry
C4F17_11280       CDS       T05380                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00020  Citrate cycle (TCA cycle)
vam00190  Oxidative phosphorylation
vam00650  Butanoate metabolism
vam01100  Metabolic pathways
vam01110  Biosynthesis of secondary metabolites
vam01120  Microbial metabolism in diverse environments
vam01130  Biosynthesis of antibiotics
vam01200  Carbon metabolism
Module
vam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vam_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C4F17_11280
   00650 Butanoate metabolism
    C4F17_11280
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C4F17_11280
Enzymes [BR:vam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C4F17_11280
    1.3.5.4  fumarate reductase (quinol)
     C4F17_11280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 HI0933_like GIDA Pyr_redox_3 FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AVQ81486
UniProt: A0A2P1V8F9
LinkDB All DBs
Position
1:2427477..2429285
Genome map
AA seq 602 aa AA seqDB search
MTYTKEKITKRKFDVVIVGAGGSGMRASLQLARAGLNVAVLSKVFPTRSHTVAAQGGVGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQKNVEARTQFFVEWMALDLIRDDEG
DVVGVTALEMETGDLHILQAKTVLLATGGAGRIFQASTNAFINTGDGLGMAARSGIPLQD
MEFWQFHPTGVAGAGVLLTEGCRGEGAILLNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDYVLLKLDHLGADTIHKRLPSVYEIGVNFANVDITKEPIPVVPTIHYQ
MGGIPTNIHGQVVVQKGEDNSAVVNGLYAVGECSCVSVHGANRLGTNSLLDLLVFGRAAG
NHIVEFNDKLKEHKPLPNDAADRTLERLNRLESTTTGEYAQDVAGEIRAVMQQHAAVFRK
QASMDEGVVKIAAVRERVKAIGLKDKSKVFNTARIEALEVDNLIEVAQATMVSAAARKEC
RGAHTVEDYERPADDPVAPLGRDDANWMKHTLWYSEDNRLSYKPVKLQPLTVASVPPKVR
TF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacctacacaaaagaaaaaatcaccaagcgcaagttcgacgtcgtgatcgtcggtgcc
ggcggctccggcatgcgcgcctcgctgcaactcgcacgtgccggcctcaacgtggccgtg
ctctccaaggtgttcccgacccgttcgcacaccgtcgctgcccagggcggcgtgggcgcc
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgcgaagcaccgaaggtc
gtgtacgagctcgaacacttcggcatgccgttcgaccgcaaccccgacggcaccatctac
cagcgtccgttcggcggccacaccgccaactacggcgagaagcccgtgcagcgcgcctgc
gccgcggccgaccgcaccggccacgcgatgctgcacacgctctaccagaagaacgtcgaa
gcccgcacccagttcttcgtcgaatggatggcgctcgacctcatccgtgacgacgaaggc
gacgtggtcggcgtgaccgccctcgaaatggaaaccggcgacctgcacatcctgcaggcc
aagaccgtgctgctggccaccggcggcgcgggccgcatcttccaggcctcgaccaacgcc
ttcatcaacaccggcgacggcctcggcatggctgcccgctcgggcattccgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgctgaccgaa
ggctgccgcggcgaaggcgcgatcctgctgaacagcaacggcgaacgcttcatggagcgc
tatgcgcccacgctgaaggaccttgcgccgcgcgacttcgtctcgcgctccatggaccag
gaaatcaaggaaggccgaggctgcggtcccaacaaggactacgtgctgctcaagctcgac
cacctgggcgccgacaccatccacaagcgcctgccctcggtgtacgaaatcggcgtcaac
ttcgccaacgtcgacatcacgaaggaaccgatccccgtcgtgccgaccatccactaccag
atgggcggcatccccaccaacatccacggccaggtcgtggtgcagaagggcgaggacaac
agcgccgtggtgaacggcctctacgccgtgggcgaatgctcctgcgtgagcgtgcacggc
gccaaccgcctgggcacgaactcgctgctcgacctgctggtgttcggccgcgcggccggc
aaccacatcgtcgagttcaacgacaagctcaaggaacacaagcccctgcccaacgatgcg
gccgaccgcacgctggagcgcctgaaccgcctcgagtcgaccaccaccggcgaatacgcc
caggacgtggccggcgagatccgcgccgtcatgcagcagcatgccgccgtgttccgcaag
caggcctcgatggacgaaggcgtggtcaagatcgccgccgtgcgcgagcgcgtcaaggcc
atcggcctgaaggacaagtcgaaggtgttcaacaccgcccgcatcgaagcgctggaagtc
gacaacctgatcgaagtggcgcaggccaccatggtttccgcagcagcccgcaaggaatgc
cgcggcgcgcacacggtggaagactacgaacgcccggcggacgacccggtcgcaccgctc
ggccgcgacgacgccaactggatgaagcacacgctctggtacagcgaagacaaccgcctg
tcgtacaagccggtcaagcttcagcccctgacggtcgcctcggtgcccccgaaggtccgg
acattctaa

DBGET integrated database retrieval system