KEGG   Variovorax sp. PMC12: C4F17_11285Help
Entry
C4F17_11285       CDS       T05380                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00020  Citrate cycle (TCA cycle)
vam00190  Oxidative phosphorylation
vam00650  Butanoate metabolism
vam01100  Metabolic pathways
vam01110  Biosynthesis of secondary metabolites
vam01120  Microbial metabolism in diverse environments
vam01130  Biosynthesis of antibiotics
vam01200  Carbon metabolism
Module
vam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vam_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C4F17_11285 (sdhB)
   00650 Butanoate metabolism
    C4F17_11285 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C4F17_11285 (sdhB)
Enzymes [BR:vam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C4F17_11285 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     C4F17_11285 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_4 Fer2
Motif
Other DBs
NCBI-ProteinID: AVQ81487
UniProt: A0A2P1V8H7
LinkDB All DBs
Position
1:2429302..2430003
Genome map
AA seq 233 aa AA seqDB search
MKRTFQIYRYDPDKDAKPYMQTVEIELDGHERMLLDALMKLKAQDPTLSFRRSCREGVCG
SDAMNINGKNGLACLTNMNTLKGTVVLKPLPGLPVIRDLIVDMTQFFKQYNSIKPYLQND
SVPPEKERLQSPEEREELNGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDEATAERLDNLEDPYRLFRCHTIMNCVDVCPKSLNPTKAIGKIKELMVRRAI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcacattccagatctaccgctacgacccggacaaggacgccaagccctacatg
cagaccgtcgagatcgaactcgacggccatgagcgcatgctgctcgacgccctgatgaag
ctcaaggcgcaggacccgacgctgtcgttccgccgttcgtgccgcgaaggcgtctgcggc
tccgacgcgatgaacatcaacggcaagaacggtctggcctgcctgaccaacatgaacacg
ctcaagggcaccgtggtgctcaagccgctgccgggcctgcccgtcatccgcgacctgatc
gtggacatgacgcagttcttcaagcagtacaactcgatcaagccgtacctgcagaacgac
agcgtgccgcccgagaaggagcgcctgcagtcgcccgaagagcgcgaagagctcaacggc
ctgtacgagtgcatcctgtgcgcgagctgctccacgagttgcccgagcttctggtggaac
cccgacaagttcgtgggcccggccggcctgctgcaggcctaccgcttcatcgccgacagc
cgcgacgaagccaccgccgagcgcctggacaacctggaagacccgtaccgcctgttccgc
tgccacacgatcatgaactgcgtggacgtgtgcccgaagagcctgaacccgaccaaggcc
atcggcaagatcaaggaattgatggtgcgccgcgccatctga

DBGET integrated database retrieval system