KEGG   Variovorax sp. PMC12: C4F17_14565Help
Entry
C4F17_14565       CDS       T05380                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00473  D-Alanine metabolism
vam00550  Peptidoglycan biosynthesis
vam01100  Metabolic pathways
vam01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C4F17_14565
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C4F17_14565
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    C4F17_14565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vam01011]
    C4F17_14565
Enzymes [BR:vam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C4F17_14565
Peptidoglycan biosynthesis and degradation proteins [BR:vam01011]
 Precursor biosynthesis
  Amino acid ligase
   C4F17_14565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST CPSase_L_D2 ATP-grasp GARS_A TTL Neuropep_like ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AVQ82086
UniProt: A0A2P1VA86
LinkDB All DBs
Position
1:complement(3120422..3121393)
Genome map
AA seq 323 aa AA seqDB search
MSLQDPKLFGKVAVLFGGSSAEREISLMSGTGVLEALRSRGVDAHAFDPSQRELADLKRE
GFARCFVALHGRHGEDGTVQGALELLGIPYTGSGVMASSVAMDKVMTKRIWQADGLPTPK
YVRLAFDQQSREQVMAVPDVLGLPLIVKPPREGSSIGVTKVEGYSQMQDAITLSAKYDAD
VLCEEFIEGEEVTCAVLGHGLDARALPVVRIAAPEGAYDYQNKYFTDDVKYQCPSGLPEA
EEHEIQRITLAAYRTLGCRGWGRADVMIRASDRKPFLLEMNTSPGMTSHSLVPMSARAAG
IAYEELCVRVLASATLDATGGSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagccttcaggatcccaaactcttcggcaaggtcgccgtgctgttcggcggcagttcc
gccgaacgcgaaatctcgttgatgtcgggcactggcgtgctcgaagccctgcgctcgcgc
ggcgtcgacgcgcatgccttcgacccctcgcagcgcgagctggccgatctcaagcgcgaa
ggcttcgcgcgctgcttcgtcgcgctgcacggccgccacggcgaggacggcacggtgcag
ggcgcgctcgagctgctcggcattccctacaccggctcgggcgtgatggcttccagcgtg
gccatggacaaggtcatgaccaagcgcatctggcaggccgacggcctgcccacgcccaag
tacgtgcgcctggccttcgaccagcaaagccgcgagcaggtcatggccgtgcctgacgtg
ctcggcctgccgctgatcgtgaagccgccgcgcgagggctcgtccatcggcgtgaccaag
gtcgagggctactcccagatgcaggacgcgatcacgctctcggccaagtacgacgcagac
gtgctctgcgaagagttcatcgaaggcgaggaagtgacctgcgccgtgcttggccacggg
ctcgacgcgcgtgcgctgcctgtggtgcgcatcgccgcgcccgaaggcgcctacgactac
cagaacaagtacttcaccgacgacgtgaagtaccagtgcccgagtggcctgcccgaggcg
gaagagcacgagatccagcgcattacgctggccgcctaccgcacgctcggctgccgcggc
tggggccgtgccgacgtgatgatccgcgccagcgaccgcaagcccttcctgctcgagatg
aacacctcgcccggcatgaccagccactcgctggtgccgatgtcggcccgcgccgcgggc
atcgcctacgaagaactctgcgtgcgggtgctggcctcggccacgctcgacgccacggga
ggctcgttatag

DBGET integrated database retrieval system