KEGG   Variovorax sp. PMC12: C4F17_23045Help
Entry
C4F17_23045       CDS       T05380                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C4F17_23045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vam02000]
    C4F17_23045
Enzymes [BR:vam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C4F17_23045
Transporters [BR:vam02000]
 Other Transporters
  Pores ion channels [TC:1]
   C4F17_23045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AVQ83595
UniProt: A0A2P1VEK7
LinkDB All DBs
Position
1:4940947..4941621
Genome map
AA seq 224 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELELPYEIVHYQRDPQTMLAPASLRAVHPLGKSPVVTTGD
GLTLAESGAIVETLIERFGNGRLAPAPGTPDAVRYRYWLHFAEGSAMSPLLLKLVFDRIE
TTKMPFFAKPIAKAIASKTKSAFINPNILSHLNFMEAELGKSEWFAGDVFTGADIQMSFP
VEAAQARGGLDAKRPKLMAYLERIHARPAYKRALERGGPYGLLS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgtccaccacctcaacaattcgcgctcgcagcgcgtgctctggctgctcgaa
gagctcgagctgccttacgagatcgtccactaccagcgcgatccgcagaccatgttggcg
cccgcttcgctgcgggccgtgcatccgctgggcaagtcaccggtggttacgacgggtgac
gggctcacgctcgcggagtcgggggcgatcgtggagacgctcatcgagcgcttcggcaac
ggccgtctcgcgcccgcgccgggcacgccggatgcggtgcgctatcgctactggctgcac
ttcgccgaaggctcggcgatgtcgccgctgctgctcaagctggtgttcgaccgcatcgag
accacaaagatgccgttcttcgcgaagccgattgccaaggccatcgcgagcaagaccaag
tcggcgttcatcaatccgaacatcctgagccacctgaatttcatggaggccgagctcggc
aagagcgagtggtttgccggcgacgtgttcaccggcgctgacatccagatgagctttccg
gtcgaggcggcgcaggcgcgcggcgggctcgatgcgaagcggccgaagctcatggcctac
ctggagcgcatccacgcgcgcccggcgtacaagcgcgcgctcgagcgcggcggtccctac
ggcctgctgagctga

DBGET integrated database retrieval system