KEGG   Variovorax sp. PMC12: C4F17_24730Help
Entry
C4F17_24730       CDS       T05380                                 

Gene name
argJ
Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
vam  Variovorax sp. PMC12
Pathway
vam00220  Arginine biosynthesis
vam01100  Metabolic pathways
vam01110  Biosynthesis of secondary metabolites
vam01130  Biosynthesis of antibiotics
vam01210  2-Oxocarboxylic acid metabolism
vam01230  Biosynthesis of amino acids
Module
vam_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:vam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    C4F17_24730 (argJ)
Enzymes [BR:vam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     C4F17_24730 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     C4F17_24730 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AVQ83894
UniProt: A0A2P1VFG8
LinkDB All DBs
Position
1:5280782..5282011
Genome map
AA seq 409 aa AA seqDB search
MPVNLSAPDPAALFAVPGVRIGVAEAGVRKANRKDLTVVLIDEGSAVGGVFTQNRFCAAP
VQVCREHLAANHGIRAMVINTGNANAGTGEDGLMRTRSTCIALARKLEISPEQILPFSTG
VIMEPLPVDRIEAGLPAALADASADHWARAAEGIMTTDTIPKAFSQRAQVGGATVTITGI
SKGAGMIRPNMATMLGFMATDAKIDPSLIQPLAKVLADASFNRVTIDGDTSTNDSFVVIA
TQKAANAAITSLDSADGKALVAAMQDVARQLAQAIVRDGEGATKFITVQVDGGRNAAECR
QVAYAVAHSPLVKTAFYASDPNLGRILAAVGYAGIDDLDQTGIDLFLDDVHVAVKGGRNP
SYREEDGQRVMKQSEITVRIGLGRGDASETVWTCDFSHEYVTINADYRS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgaacctgtctgctcccgatcccgccgcgctgttcgcggtgcctggtgtccgc
atcggcgtggccgaagcgggcgtgcgcaaggccaatcgcaaggacctgaccgtcgtgctg
atcgacgaaggctccgccgtcggcggcgtgttcacccagaaccgtttctgcgccgcgccg
gtgcaggtctgccgcgagcacctggccgcgaaccacggcatccgcgcgatggtgatcaac
accggcaacgcgaacgccggcacgggcgaagacgggctgatgcgcacgcgctccacctgc
atcgcgctggcgcgcaagctggaaatctcgcccgagcagatcctgccgttctccaccggc
gtgatcatggagccgctgcctgtcgatcgcatcgaagccggcctgccggccgcgctggcc
gatgcttccgcggaccactgggcgcgcgcggccgagggcatcatgaccaccgacaccatc
ccgaaggccttcagccagcgggcccaggtcggcggcgcgacggtcaccatcaccggcatc
agcaagggcgccggcatgatccgcccgaacatggcgaccatgctcggcttcatggcgacc
gacgcgaagatcgatccctcgctcatccagccgctggccaaggtgctggcggatgcctcg
ttcaaccgcgtgaccatcgacggcgacacctccacgaacgactcgttcgtggtcatcgcg
acgcagaaggcggccaacgccgccatcacctcgctcgactcggccgacggcaaggcgctg
gtggccgccatgcaggacgtggcgcgtcagttggcgcaggccatcgtgcgcgacggcgaa
ggcgcgaccaagttcatcaccgtgcaagtcgatggcggccgcaacgccgcggagtgcagg
caggtggcctacgccgtggcgcattcgccgctggtcaagacggccttctacgccagcgac
ccgaacctgggccgcatcctggcggctgtcggctatgcgggcatcgacgacctcgaccag
acgggcatcgacctgttcctcgacgacgtgcacgtggcggtcaagggcgggcgcaatccg
tcgtaccgcgaggaagacggccagcgcgtgatgaagcagagcgagatcacggtgcgcatc
ggcctgggccgcggcgacgccagcgaaaccgtgtggacctgcgacttcagccacgaatac
gtgaccatcaacgccgactaccggtcatga

DBGET integrated database retrieval system