KEGG   Variovorax sp. PMC12: C4F17_25900Help
Entry
C4F17_25900       CDS       T05380                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
vam  Variovorax sp. PMC12
Brite
KEGG Orthology (KO) [BR:vam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C4F17_25900
Enzymes [BR:vam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     C4F17_25900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 PrmA MTS Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AVQ84108
UniProt: A0A2P1VG04
LinkDB All DBs
Position
1:5518360..5519424
Genome map
AA seq 354 aa AA seqDB search
MRLRCMCLVIHAPDYLRLDEQDAGEIGPGQVLVKVGMGGICGSDLHYFHNGGFGTVRIKE
PMVLGHEVAGTVVAVAPGVESVRIGDKVAVNPSRPCGACKFCLEGLPNQCLDMRFYGSAM
RTPHVQGAFRNMLLCEATQCVKVADHVPLRLAALAEPFSVGLHGVSRAGPLLGKRVLVSG
CGPIGVLAIAAARAHGAAEITATDVVDEPLAIARAMGADRTINVAQDKTWVSRHSADKGT
FDVMLECSGNERALRDGLEVMRPRGVVVQLGLGGDVSIPQNMVVSKELSICGSFRFHAEF
ALAVRLINEGRVDLSPVVTHTFPMLKAREAFELASDRKQAMKVLIDFADAGAAA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgcgttgtatgtgcctcgtgatccacgcccccgactacctgcggctggacgaa
caggacgccggggaaatcggccccggccaggtattggtgaaggtcggcatgggcggcatc
tgcggctccgacctgcactactttcacaacggcggtttcggcaccgtgcgcatcaaggag
ccgatggtgctgggccacgaggtggccggcaccgtggtggcggtggcgcccggcgtggag
agcgtgcgcatcggcgacaaggtggccgtcaacccgagccgcccctgcggcgcctgcaag
ttctgcctcgaaggcctgcccaaccagtgcctggacatgcgcttctacggcagcgcgatg
cgcacgccgcatgtgcagggcgcgttccgcaacatgctgctgtgcgaggccacgcagtgc
gtgaaggtggccgaccacgtgccgctgcggctggccgcgctggccgagccgttctcggtg
gggctgcacggcgtgtcgcgtgccgggccgctgctgggcaagcgcgtgctggtgtcgggc
tgcggcccgatcggcgtgctggccatcgcggcggcgcgcgcgcacggcgcggccgagatc
accgccaccgacgtggtcgacgagccgctggccattgcacgcgccatgggcgccgaccgg
accatcaatgtcgcgcaggacaagacctgggtgtcgcgccattcggccgacaagggcacc
ttcgacgtgatgctcgaatgctccggcaacgaacgcgcgctgcgcgacggcctggaagtg
atgcgcccgcgcggcgtggtcgtgcagctcggcctgggcggcgacgtgagcattccgcag
aacatggtggtgtcgaaggaactgagcatctgcggctcgttccgcttccatgccgagttc
gcgctggcggtgcggctcatcaacgaaggccgggtcgacctgtcgccggtggtgacgcac
accttcccgatgctgaaggcgcgcgaggccttcgagctggcgagcgaccgcaagcaggcg
atgaaggtgctgatcgactttgcggatgcgggagcggcagcctga

DBGET integrated database retrieval system