KEGG   Vibrio anguillarum 775: VAA_00329Help
Entry
VAA_00329         CDS       T01536                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
van  Vibrio anguillarum 775
Pathway
van00473  D-Alanine metabolism
van00550  Peptidoglycan biosynthesis
van01100  Metabolic pathways
van01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VAA_00329
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAA_00329
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VAA_00329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
    VAA_00329
Enzymes [BR:van01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VAA_00329
Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
 Precursor biosynthesis
  Amino acid ligase
   VAA_00329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEH34441
UniProt: F7YRU4
LinkDB All DBs
Position
II:complement(23169..24173)
Genome map
AA seq 334 aa AA seqDB search
MTQTTILLLCGGGSSEHEVSLVSANYLQAQLEKTEGFQVIRVEMRPDGWYSEKGDLSFLD
TNAATLNTNGVAVNIDFVVPCIHGYPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALGIPNTPYLFLSENNAQAHQQCKQALEKWGSVFIKAARQGSSVGCYKVTEVSQL
NSAIDAAFSYSEQVLVEKAVKPRELEVAAYQLDGVLYLSKPGEIIAPEDAFYTYEEKYSA
ASHSMTEVQAQNLTREQLEMISDCAARVFTHMKLRHLARIDFFLTPEGNIYLNEVNTFPG
MTPISMFPKMLEHNGHRFHEFLANCVTTSLNQKV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacaacaatcctattattatgtggtggcggttcgtcagaacatgaagtttca
cttgtgtcagccaactatttacaagcacaacttgaaaaaacagaaggttttcaagttatt
cgcgtcgaaatgcgacccgatggttggtacagtgaaaagggcgacctgagtttcttagac
acgaatgctgcaacgttgaataccaatggtgttgccgtcaatatcgattttgtggttcct
tgcattcatggttatccaggggaaacgggcgacattcaatcgatgctcgagctggctggc
atcccatatttaggttgtggtccagaagccagtgctaacagctttaataaaattacatct
aagctttggtacgatgcgctgggtattcctaatacaccttatctttttctttcagaaaat
aatgcacaagcgcatcagcagtgtaagcaggctctggaaaaatggggaagtgtgtttatt
aaagcggcgagacaaggctcatctgttggttgttacaaagtcaccgaggtttcacagctc
aacagcgcaatcgatgcggcttttagctactcggaacaagttctggttgaaaaagcagtg
aaacctagggaattagaagttgccgcttatcagcttgatggtgttttatatctttctaag
ccgggtgagatcatcgcaccagaagacgcattttatacttatgaagaaaaatacagtgcg
gctagccattcgatgactgaagtacaagctcagaatttaaccagagaacaattagaaatg
ataagtgattgtgctgctagggtttttacccacatgaagcttaggcaccttgcacgtatt
gatttctttttaaccccagagggaaacatttatcttaatgaagttaacaccttccctggc
atgactcccatttcaatgtttcctaaaatgttagagcataatgggcataggtttcatgaa
tttctagccaattgcgtgacaacgtcactcaatcaaaaggtttaa

DBGET integrated database retrieval system