KEGG   Vibrio anguillarum 775: VAA_01098Help
Entry
VAA_01098         CDS       T01536                                 

Definition
(GenBank) Cell elongation specific D,D-transpeptidase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
van  Vibrio anguillarum 775
Pathway
van00550  Peptidoglycan biosynthesis
van01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAA_01098
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    VAA_01098
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
    VAA_01098
Enzymes [BR:van01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VAA_01098
Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   VAA_01098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AEH33719
UniProt: F7YMR8
LinkDB All DBs
Position
I:2312200..2314080
Genome map
AA seq 626 aa AA seqDB search
MLRKRSQIRDYQSEARLFRNRAIVSFIAIIMLVGVLLTNLYHIQINQYQDYKTRSNDNRI
KIVPIAPNRGLIYDRNGVLLAENRPVFNLEITPEQVRDMDDTITRLQQYLTISPEKIATF
EKERRQTRRFNSVPLLTQLTPEEVAIFSVNQHKFPGVSVSASLKRYYPYGEVLTHVIGYV
SRINDRDMERLEREERSANYQATRDIGKLGIERFYEDVLHGTAGYQEVEVNSRGRIIRTL
KYVPPVAGKDIVLSLDIDLQLYVHKLLDGRRGSIVVLDPKDNGVLTMASSPSYDPNPFVH
GISSAAYNELLNDPDRPLVNRATLGIYPPGSTIKPFIAVAALQEGVITPTTTRNDPGYWV
IPNSKTRPFRDWLRWGHGRVDINKALEESVDTFFYQIAYDLGIDRLSSWMMKFGFGDYTG
LDIYEEGKANMPTREWKMARHRTPWYQGDTIPVGIGQGYWTSTPMQIAKATSVLVNHGKV
IAPHLLRSTLKNGEEFSRQELSELETSPPIEGVPKRYWDIAINGMRLVNHGKKGTARRSF
TNMKYVSAGKSGTAQVFGLAENQVYKADELAEHLRDHALFTGFAPVDDPQLIVTLVLENA
GGGSGNGGPVVRKIFDRAILGKEAEK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtaagcgtagccaaattcgtgactaccaatcagaagctcggctgtttcgcaac
cgagcaattgtctcttttattgcgatcatcatgctggtgggcgttctgcttaccaatttg
taccatattcaaattaaccaatatcaagattacaaaacgcgatccaacgataaccgaatc
aaaatcgtcccgattgcgcctaatcgagggttaatttatgaccgcaatggtgtgctacta
gcggaaaaccgcccagtattcaacttagagatcacacctgagcaagtgcgcgatatggat
gatacgatcacgcgcttacagcaatacctgaccatctcaccagaaaaaattgccaccttt
gaaaaagagcgtcgtcagacacgccggtttaattcagtgccgcttttgacacaattaaca
ccggaagaagtggctattttttcggtcaatcagcacaagtttcccggtgtatcagtaagc
gcaagcttaaagcgctactacccctatggtgaagttctcactcatgttatcggttatgta
tccaggatcaatgaccgagatatggaacgtctagaacgcgaagagcgctcagccaattac
caagccactcgtgatattggcaaactggggattgaacgcttttatgaggatgtgctgcac
ggtacggctggctaccaagaagttgaggtcaatagccgaggacgcatcattcgcacctta
aaatacgtccctcccgtggcagggaaagacattgtattaagcttggacattgatctgcag
ctttatgtgcacaagttgttggatggccggcgaggttcaattgtagtgctcgatccaaaa
gataacggtgtccttaccatggcatcaagtccaagctacgatccaaacccattcgtacat
ggtatttctagcgccgcctacaacgaacttctcaatgacccagaccgcccgttagtcaat
cgagcgacacttggtatttaccctcccggctcaacgattaaaccttttattgccgtcgct
gcacttcaagaaggggttataaccccaacaacaacacgtaatgatcctggttattgggtg
ataccaaactccaaaacgcggcccttccgagactggttgcgctgggggcatggtcgagtg
gacattaataaggcgctcgaagagtctgtcgatactttcttttaccaaatcgcctacgac
ttgggtattgatcgtctctctagttggatgatgaaatttggctttggtgactatacaggt
ttagacatttatgaagaaggcaaagcgaacatgccaacgcgtgaatggaaaatggcacgt
caccgaaccccttggtatcaaggtgatacgattccggtcggcattggccaagggtattgg
acatcaacaccgatgcaaattgccaaagcgacttccgtgctggttaatcacggcaaagtg
attgcgccgcatttattgcgttcgacgctcaaaaatggtgaagagtttagcaggcaagag
ctttcagaattagaaacttcgccaccgatcgaaggggtgccgaaacgctattgggacatc
gcaatcaatggcatgcgtcttgtaaaccacggcaaaaaaggaaccgcacggcgctcattt
accaatatgaaatatgtcagcgctggaaaatctggaactgcgcaagtgtttggcttggca
gaaaaccaagtgtataaggccgatgaattagccgaacaccttcgtgaccatgccctattc
acaggctttgcacctgtagatgacccgcagcttattgtcactctggtactcgaaaacgca
gggggaggttctggcaatggtggacccgttgttaggaaaatatttgaccgcgccattcta
ggtaaagaggctgaaaaataa

DBGET integrated database retrieval system