KEGG   Vibrio anguillarum 775: VAA_01101Help
Entry
VAA_01101         CDS       T01536                                 

Definition
(GenBank) D-alanyl-D-alanine serine-type carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
van  Vibrio anguillarum 775
Pathway
van00550  Peptidoglycan biosynthesis
van01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAA_01101
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:van01002]
    VAA_01101
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
    VAA_01101
Enzymes [BR:van01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VAA_01101
Peptidases [BR:van01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   VAA_01101
Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VAA_01101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AEH33722
UniProt: F7YMS1
LinkDB All DBs
Position
I:2316079..2317257
Genome map
AA seq 392 aa AA seqDB search
MKKHTFLKPILASSIALSATFTSSVFSAPIVIPDAPQIAAKGYVLMDYHSGKVLAEKEMN
TKLSPASLTKMMTSYVIGQELKRGNISPQDKVVVSKNAWAKNFPDSSKMFIEVGTTVTVE
ELNKGIIIQSGNDACVAMAEHIAGSEDAFVDLMNAWASSLKMSNTHFANVHGLDNPNLYS
TPYDMALLGQALIRDVPNEYRIYSEQKYTYNGITQYNRNGLLWDKSMNVDGIKTGHTSNA
GYSLVSSATEGKMRLIAVVMGTKDENARKSESKKLLSYGFRFFETVAPHKAGETFVEEKI
WMGDKDKVALGVNEDTYVTLPRGQAKDLSASFVLEKELRAPISQGDVVGKLYYQLDGKDV
AEYPLLALENVDEGSIFSRLWDYIILLFKGLF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacacacattcttaaaaccgattctagcgtcttctattgcgctttctgcaacc
tttactagctcagtattttctgcgcctatcgtgatacctgatgctcctcaaattgccgct
aaaggctatgtgttgatggactaccattcaggtaaagtgctggcagaaaaagagatgaac
acaaaactttcacctgcaagtttgacgaaaatgatgaccagctacgtgattggccaagaa
cttaaacgtggcaatatctctccacaagataaagtggtggtcagtaaaaatgcgtgggct
aaaaacttccctgactcgtctaaaatgtttattgaagtcggcaccacagtaacggtagaa
gaactgaacaaaggtatcatcattcagtctggtaatgacgcttgcgtggcgatggctgaa
cacattgctggctcagaagacgcttttgttgacctaatgaatgcgtgggcaagttcacta
aaaatgagcaatacgcactttgctaacgtacacggtctagataacccaaatctctattca
actccatatgacatggcgctactaggtcaagcgttgattcgtgatgtaccaaacgagtac
cgtatttattcagagcagaaatatacctataacgggattacccagtacaaccgaaatggt
ttgctgtgggataaaagtatgaacgtagatggtattaaaaccggtcatacgagtaatgct
gggtacagtttagttagctctgcaacggaagggaaaatgcgcctcattgctgtggttatg
gggaccaaagatgaaaatgctcgtaaatcagaaagtaaaaaacttctgagctatggcttt
agattcttcgaaaccgttgcgccacacaaagcaggtgaaacattcgtcgaagaaaaaatc
tggatgggtgacaaggataaagtggcgcttggtgtcaatgaagatacttacgttacactc
cctcgcggtcaagcgaaggatctcagcgcaagctttgttcttgaaaaagagctcagagcg
ccaataagccaaggtgatgtggtcggtaagctttactaccagcttgatggcaaagacgtg
gctgaataccctcttttggcattagagaatgttgatgaaggcagcatatttagccgtctt
tgggactacattatattacttttcaaagggttattctga

DBGET integrated database retrieval system