KEGG   Vibrio anguillarum 775: VAA_01439Help
Entry
VAA_01439         CDS       T01536                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
van  Vibrio anguillarum 775
Pathway
van00473  D-Alanine metabolism
van01100  Metabolic pathways
van01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VAA_01439
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VAA_01439
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
    VAA_01439
Enzymes [BR:van01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VAA_01439
Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
 Precursor biosynthesis
  Racemase
   VAA_01439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Virul_Fac
Motif
Other DBs
NCBI-ProteinID: AEH33126
UniProt: F7YIL5
LinkDB All DBs
Position
I:complement(1653243..1654466)
Genome map
AA seq 407 aa AA seqDB search
MNFKASFLTLSIAMALPSFSATSAPLSLNVSEPSIQEIQQSNTWLEIDLGQFKQNIEQFK
SHINSQTKICAVMKADAYGNGIRGLMPTILAQGIPCIAITSNAEARAVRESGFKGQLMRV
RSASIDEIAQSVELDIEELIGSKIQAEQLAQLSQQKGKTIRVHLALNDGGMGRNGIDMST
DAGKQESIAIATQSGIQIVGIMTHFPNYNPDEIRSKLASFNTNSAWLIQQANLKRDELIL
HVANSYTALNVPEAQLDMVRPGGVLYGDLPTNPEYPSIVSFKTRIASLHHLPKGSTVGYD
STYRVTKESVLANLPVGYSDGYPRKMGNRGDVLINGQRAKVVGVTSMNTTLVDVTDVKGV
LPNQEVTLFGAQKQGRITVSELEENAELIFPELYTIWGTANPRFYIH
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaaagcctcttttcttacactgtcaattgccatggctttaccctctttttca
gcgacttctgcacctttaagccttaacgtcagtgagccttctatacaagaaattcagcaa
tccaatacttggcttgagatcgatcttggccaattcaaacaaaatattgagcagtttaag
agccacatcaacagccaaactaaaatttgcgccgtgatgaaggctgatgcttacggcaac
ggtattcgcggtttaatgccaactattctcgcgcaagggatcccttgtatcgcaattacc
agtaatgcagaggctagagccgtacgtgagagcgggtttaaaggccagttgatgcgtgtt
cgctctgcgagcattgatgaaatcgcacaaagtgtcgagttagatatcgaagagctaatc
ggtagtaaaatacaagctgagcaactcgctcagctaagccagcaaaaaggtaaaacgata
agagtacatttggcattaaatgatggcggtatgggacgcaatggtatcgatatgtcaacc
gatgcaggaaaacaagaatcgattgcgattgctactcaaagtggcatacaaattgttggg
ataatgactcatttccccaattacaatccagacgaaatccgcagcaagttggccagtttt
aataccaattcagcttggttgattcagcaagcaaacctaaaacgcgatgagctgattttg
catgttgccaactcctacactgctctcaatgtaccagaagcacaacttgatatggtacgt
cctggcggcgtcctatatggcgacttaccaactaacccggaatatccgtcaatcgtctca
ttcaaaacacgtattgcgtcattgcatcatcttcctaaaggaagcactgttggctatgac
agtacataccgcgtaaccaaagagagtgttttggcaaatctgcctgttggctattcagat
ggttacccaagaaaaatgggcaatcgcggtgacgtattgattaacggtcaacgagcaaag
gtggttggagtaacttcaatgaacaccacattggttgacgtaaccgatgtgaaaggcgtc
cttcctaatcaggaagtcaccttgtttggcgcgcaaaagcaaggccgaatcactgtcagt
gagctggaagaaaatgcagagctcatattccctgaactgtatacgatttggggaacggca
aaccctcgtttctacatccactaa

DBGET integrated database retrieval system