KEGG   Vibrio anguillarum 775: VAA_02128Help
Entry
VAA_02128         CDS       T01536                                 

Definition
(GenBank) Cystathionine beta-lyase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
van  Vibrio anguillarum 775
Pathway
van00270  Cysteine and methionine metabolism
van00450  Selenocompound metabolism
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01230  Biosynthesis of amino acids
Module
van_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VAA_02128
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VAA_02128
Enzymes [BR:van01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     VAA_02128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEH33392
UniProt: F7YKD9
LinkDB All DBs
Position
I:1949552..1950748
Genome map
AA seq 398 aa AA seqDB search
MSEGKKTLLVNAGRSKKWTNGVVNPPIQRASTVVFDSVAEKNQATVNRANKTLFYGRRGT
HTHFAFQEAMVEIEGGVGCALFPCGAAAIANSILSFVQTGDHILMVDTCYEPTRDFCEKI
MKKMGIETTYYPPTIGEGIRALIQPNTKVLFTESPGSITMEVQDIPTLARVAHEHDIIVM
LDNTWAAGVNFSPFEHGVDISIQAATKYIVGHSDVMLGTAIANEKCWDQLREQSYLMGQC
VSPDDAYLGLRGLRTLDVRLRQHAQNSLTIAHWLAEQPEVDHVRHPALETCPGHEFYQRD
FTGGNGLFSFVLKSSDAKATTALLDGMQHFSMGFSWGGFESLILANEPKSFDSLRTVAHP
HFAGTLIRVHIGLEDIDDLIADLKAGLERYSAQLALRA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaggtaaaaaaacactgttggtcaatgcgggtcgtagtaaaaagtggaccaat
ggcgttgtcaacccacctattcagcgcgcctctaccgttgtatttgatagtgtggctgaa
aaaaatcaggccactgtcaatcgggctaataaaacactcttttatggacgccgtggtact
catacgcactttgcgttccaagaagcaatggtggaaattgaaggtggcgtcggttgcgcg
cttttcccttgcggtgcggccgccattgccaatagtattctttcctttgtgcaaacgggt
gaccatattctgatggtcgacacttgctatgaacctactcgtgatttttgtgaaaaaatc
atgaaaaaaatgggcatagaaacgacctactacccaccgaccataggtgaaggaatccgt
gctttgatccaacccaataccaaagtgttgttcactgaatcgcccggttcgatcacgatg
gaagtgcaagatatcccaaccttagcgcgggttgcacatgaacatgacatcattgtcatg
ctagataacacttgggcggcaggcgtgaacttttcaccttttgaacatggtgttgatatt
tcgatccaagcggcgacgaaatacattgttggccactcagacgtgatgttaggaacagcg
attgccaatgaaaaatgctgggatcaattacgagagcaaagctatttgatgggacaatgt
gtctcacctgatgacgcttatttagggctacgagggctaagaacgttagatgttcgctta
cgtcagcatgctcaaaatagcttaaccattgcgcactggttagcagagcaacctgaagtg
gatcatgttcgccatcctgcgctagagacttgtcctggacatgagttttatcagcgtgat
ttcactggtggcaacgggctgttttcatttgtattaaagagcagtgatgcaaaagctacg
acggctttgctcgatggcatgcaacattttagtatgggcttttcatggggtgggtttgaa
agcctaattttagctaatgaacccaaaagctttgatagtttaagaaccgtcgcacacccg
cactttgcaggtacattgatccgagtgcatattggtcttgaagatatcgacgatctgatc
gctgatctaaaagcgggattagaacgctacagtgcacagcttgctctgcgtgcataa

DBGET integrated database retrieval system