KEGG   Vibrio anguillarum 775: VAA_02218Help
Entry
VAA_02218         CDS       T01536                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
van  Vibrio anguillarum 775
Pathway
van00250  Alanine, aspartate and glutamate metabolism
van00410  beta-Alanine metabolism
van00430  Taurine and hypotaurine metabolism
van00650  Butanoate metabolism
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01120  Microbial metabolism in diverse environments
van02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VAA_02218
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VAA_02218
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VAA_02218
   00430 Taurine and hypotaurine metabolism
    VAA_02218
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VAA_02218
Enzymes [BR:van01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VAA_02218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: AEH33481
UniProt: F7YL82
LinkDB All DBs
Position
I:2040921..2042564
Genome map
AA seq 547 aa AA seqDB search
MVSEQKTANVSFESLLRIFTVPEGPDSTLTKIDQELSRNLNLFLREHIVAEEKPLKEIEK
DFSNPQIPESPEFVSEHTQHLLDNLVAHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYQKNDAFYSQWMHSANHSLGAFCSGGTIANITA
LWVARNNALKADGDFQGVEKEGLFKAMRHYGYHGLAILVSDRGHYSLKKAADVLGIGQEG
LVCVKTDHNNRLCPQDLKAKMAHLKSQKIKSFAVVGVAGTTETGNIDPLRDIANICQQEG
CHFHVDAAWGGATLMSNNHRHLLNGIELADSVTIDAHKQLYIPMGAGMVLFKKPDAMHSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYELLIDQSLAKARYFADL
IKEQDDFELISEPELCLLTYRYIPAFVRQALQQALPNQKAELNELLNEITQFVQKKQRET
GRSFVSRTRLNPERWDKLDTIVFRVVLANPLTTHAILHSILDEQRHIATLAPNLMAKIEL
LAQRIIS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacaaaaaactgcaaatgtgagtttcgagagcttgttacggatcttcact
gtgcccgaaggccccgactcaacactgacaaaaatagaccaagagctatcgcgcaatttg
aacctcttcttgcgtgaacatattgtcgctgaagaaaaaccactcaaagagatcgaaaaa
gatttctctaatccgcaaattccagagtcaccggagttcgtttcagaacatactcagcat
ttgttggataatttagtcgctcattcagtgcatacctcggctcctagctttattggtcat
atgacatctgcactgccatatttcttgatgccgttatcaaagatcatgattgcgctgaat
caaaacttagtcaaaattgaaacgtcaaaagcgtttacaccgctagaacggcaggttttg
ggtatgttgcatcgtttgatctatcaaaaaaacgacgctttttacagccaatggatgcat
agcgctaatcattcgctcggtgcattttgctctggcggaacaattgccaatatcacggca
ttgtgggtggctcgtaataatgctttgaaagccgatggtgatttccaaggcgtcgaaaaa
gaggggctgtttaaagccatgcgtcattatggttaccacgggttagccattttagtgtct
gatcgtggccattactctttaaagaaagccgctgacgtattgggtatcggccaagaaggc
ttggtttgtgtaaaaaccgaccacaacaaccgcttatgcccacaagatttgaaagccaaa
atggcacacctaaaaagccagaaaattaaatcttttgcggttgttggcgtcgccggaacg
acagaaacgggcaacattgatcccttaagagatatcgccaatatttgccagcaagaaggt
tgtcattttcacgtagacgccgcttggggcggtgcaacattaatgtcgaataatcaccga
cacttactcaatggtattgagttggctgactccgtcacgattgatgcacataaacagctc
tacatccctatgggtgcaggcatggtactattcaaaaagcctgatgctatgcattcaatt
gagcaccatgcgcagtatattttgcggaaaggttcaaaagatctaggcagccatacgtta
gaaggttctcgttcaggtatggccatgttggtgtacgctagcatgcacattattagtcgc
cctggctacgaattattgattgaccaaagcctagctaaagctcgctatttcgccgatcta
attaaagaacaagacgattttgaactgatttctgaacccgaactgtgtcttttaacctat
cgttatattcctgcttttgttcgccaagcactgcaacaagccttgcctaatcaaaaagca
gaactgaacgagttgctaaatgaaatcacccagtttgtgcagaaaaaacaaagggaaacg
gggcgttcatttgtctctcgaactcgtttaaacccagaacgctgggacaagcttgatacc
attgtatttcgcgtggtactagccaacccgctaacaacacatgctatcttgcactcgatc
ttagatgagcagcgacatattgccacgctagcccctaatttgatggccaaaattgagcta
cttgctcaaagaatcatcagctag

DBGET integrated database retrieval system