KEGG   Vibrio anguillarum 775: VAA_02582Help
Entry
VAA_02582         CDS       T01536                                 

Definition
(GenBank) Cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
van  Vibrio anguillarum 775
Pathway
van00270  Cysteine and methionine metabolism
van00450  Selenocompound metabolism
van00920  Sulfur metabolism
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01230  Biosynthesis of amino acids
Module
van_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    VAA_02582
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VAA_02582
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VAA_02582
Enzymes [BR:van01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     VAA_02582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 GDC-P
Motif
Other DBs
NCBI-ProteinID: AEH32094
UniProt: F7YK21
LinkDB All DBs
Position
I:complement(540515..541681)
Genome map
AA seq 388 aa AA seqDB search
MTTRKPATIAVRTGIESDSQYHAVVPPIYLSTNYSFPAFGEVPKYDYTRSGNPNRGLLEK
ALFELESGQGAVVTNCGTSALNLWVSAFLSPDDLIVAPHDCYGGTYRLFNTRAKKGDFKT
LFIDQSDPNALQAALAKKPKLVLIETPSNPLVRVVDIADICQQAHAVGALVAVDNTFLTP
VFQKPLELGADFVIHSTTKFINGHSDVIGGVVITKTEQHAEELAWWGNCLGSTGTPFDSY
MTLRGIRTLGARMRVHEESSRAILDYLQSEALVKVIYHPSLPEHPGHEIAKKQQSGFGSM
LSFEFAGSFEQLKYFVSQLTLFSLAESLGGVESLICHPASMTHRAMGEEALAEAGVSQQL
LRLSVGLEDAQDLIDDLAQAFAKAQEAY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcgcaagccagccaccatcgccgttagaaccggtattgaatccgactctcaa
tatcatgctgttgtgcctccaatttatctttcgacaaattatagctttcctgcgtttggt
gaagtacctaaatacgattacacacgctctggcaacccaaatcgaggtctgctcgaaaaa
gcgttgtttgaactcgaatcgggtcaaggcgcggtggtgactaactgtggcacttcggcg
ctgaatctatgggtttccgcctttttaagtcctgacgatctgatcgtggccccgcatgac
tgttacggtggcacatatcgcctgtttaatacacgcgccaaaaaaggcgattttaagaca
ctctttattgatcaatccgatccaaacgctttgcaggccgctttggcgaaaaaacctaaa
ttggtactcattgaaaccccatccaacccattagttcgcgtggtagatattgctgatatt
tgccaacaagcacacgccgtcggtgcattagtggcggttgacaacaccttcttaacgcca
gtgttccaaaaaccattagagttgggcgcagattttgtcatccactccaccaccaaattc
atcaatggccactccgatgtgattggcggagttgttatcaccaaaacagagcagcacgct
gaagagctagcatggtggggcaactgccttggctcaacgggaaccccttttgatagctat
atgacgctgcgtggcattcgtaccttaggcgcaagaatgcgcgtccatgaggaaagctca
cgcgccattttggactatctgcaaagcgaagccttagtaaaggtcatttatcacccgagt
ttgccagagcatcctggccatgagattgcgaaaaagcagcaatctggctttggatctatg
ctcagttttgagtttgcgggcagctttgaacagctcaaatattttgtctctcagttaaca
ttattctcactggcagaatcattaggaggcgtggagagcttaatctgccaccccgcttcg
atgactcaccgagcgatgggcgaagaagcgttggccgaagctggtgtttcacagcagcta
ttacgcctatcggtcggcttagaagatgcccaagatttgattgacgatctcgcgcaagcc
tttgctaaagcgcaggaggcctattaa

DBGET integrated database retrieval system